Recombinant Xenopus laevis E3 ubiquitin-protein ligase RNF182 (rnf182)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your use.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
rnf182; E3 ubiquitin-protein ligase RNF182; RING finger protein 182; RING-type E3 ubiquitin transferase RNF182
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-246
Protein Length
full length protein
Species
Xenopus laevis (African clawed frog)
Target Names
rnf182
Target Protein Sequence
MTSQLSEDNSESPNLNSDELECKICYNRYNLRQRKPKVLGCCHRVCAKCLYKLVDCGESP QCVIVCPFCRFETRMPEDEVSSLPDDNNILLNLACGGRGKCVGDNPTELLLTPKRLSTIV TPSHTSTNCLVITIMEVQRESSPALNTTPMVEFYRPSNYDPVSIPQNWTVWNCTSLICKT SVRVFVWLLGLLYFSSLPLGIYLLVSKKVTLGVVFVSLVPSSLVILMIYGFCQCMCHEFL DCMSTP
Uniprot No.

Target Background

Function
Recombinant Xenopus laevis E3 ubiquitin-protein ligase RNF182 (rnf182) is an E3 ubiquitin-protein ligase that mediates the ubiquitination of ATP6V0C, targeting it for degradation via the ubiquitin-proteasome pathway.
Database Links

KEGG: xla:432148

UniGene: Xl.17893

Subcellular Location
Membrane; Multi-pass membrane protein. Cytoplasm.

Q&A

What is RNF182 and what is its primary function in Xenopus laevis?

RNF182 (Ring Finger Protein 182) is a RING finger domain-containing protein that functions as an E3 ubiquitin ligase. In Xenopus laevis, as in other organisms, it mediates the ubiquitination of target proteins, marking them for degradation via the ubiquitin-proteasome pathway. The protein contains a typical C3HC4-type RING finger domain between amino acids C20 and C67, and two putative transmembrane helices at the C-terminus .

The primary functions of RNF182 include:

  • Targeting specific proteins for degradation through the ubiquitin-proteasome pathway

  • Mediating the ubiquitination of ATP6V0C (a component involved in gap junction complexes and neurotransmitter release)

  • Possible involvement in brain development and neuronal cell death mechanisms

How is RNF182 expressed in Xenopus laevis tissues?

RNF182 expression in Xenopus follows a specific pattern:

  • It is a brain-enriched gene with relatively low expression levels

  • RT-PCR analysis shows expression in the mouse cortex, hippocampus, cerebellum, and spinal cord

  • Expression is absent in heart, liver, kidney, and skeletal muscle

  • RNF182 is upregulated during retinoic acid (RA)-induced differentiation of human NT2 cells, with increased levels detected in both neurons and astrocytes

What are the advantages of using Xenopus laevis as a model system for studying RNF182?

Xenopus laevis offers several advantages for studying proteins like RNF182:

AdvantageResearch Application
Large, abundant eggs and readily manipulated embryosFacilitates microinjection of constructs for gene expression studies
Conserved cellular, developmental and genomic organization with mammalsMakes findings potentially translatable to human disease contexts
External development and rapid organogenesisAllows easy observation of developmental effects
Ability to obtain gametes year-roundEnables continuous experimentation without seasonal limitations
Ease of genetic manipulationPermits knockdown and overexpression studies
Genome sequencing availableEnables genomic and transcriptomic analyses

Additionally, Xenopus systems have been instrumental in defining key principles of gene regulation, signal transduction, embryonic induction, morphogenesis, and cell cycle regulation .

How can one verify the E3 ubiquitin ligase activity of recombinant RNF182?

To verify the E3 ligase activity of recombinant RNF182, researchers can perform an in vitro ubiquitination assay:

Protocol overview:

  • Express recombinant RNF182 (His-tagged or GST-tagged)

  • Perform the ubiquitination reaction containing:

    • Purified E1 enzyme

    • Purified E2 enzyme

    • Recombinant RNF182 (E3)

    • Ubiquitin

    • ATP

    • Reaction buffer

  • Incubate the reaction mixture at 30-37°C for 1-2 hours

  • Analyze by SDS-PAGE and Western blotting using anti-ubiquitin antibodies

A high molecular weight smear on Western blot indicates successful ubiquitination. Essential controls include reactions omitting E1, E2, RNF182, or ubiquitin . In published experiments, GST-SIAH-1 has been used as a positive control for E3 ligase activity .

What methods can be used to study RNF182-substrate interactions?

Several complementary approaches can be used to identify and confirm RNF182 substrates:

  • Yeast two-hybrid screening:

    • This method has successfully identified ATP6V0C as an RNF182 substrate

    • The interaction was reproducibly reconstructed in the yeast two-hybrid system

  • Co-immunoprecipitation:

    • For in vivo validation of interactions

    • Fusion proteins (GST-RNF182 domains and flag-tagged potential substrates) can be co-expressed

    • Precipitation with anti-GST followed by Western blotting with anti-flag can detect interactions

  • Co-localization studies:

    • EGFP-fused RNF182 and flag-tagged substrate candidates can be co-transfected

    • Fluorescence microscopy reveals cellular co-localization patterns

    • For ATP6V0C, co-localization was observed in a punctuated pattern in cytoplasmic and perinuclear regions

How can RNF182 expression be manipulated in Xenopus systems?

Several approaches can be used to manipulate RNF182 expression in Xenopus:

Overexpression:

  • Clone the coding region of RNF182 into a mammalian expression vector (e.g., pEGFP-N1)

  • Transfect the construct into Xenopus cell lines or microinject into embryos

  • Verify overexpression by RT-PCR and Western blotting

Knockdown:

  • Design siRNAs targeting Xenopus RNF182

    • A mixture of four siRNAs has been successfully used

  • Transfect cells with the siRNA mixture

  • Verify knockdown by RT-PCR (24-48 hours post-transfection)

For developmental studies in Xenopus embryos, antisense morpholino oligonucleotides can be used. These are designed to block translation or disrupt splicing of the target mRNA .

What is the relationship between RNF182 and neurodegeneration?

RNF182 shows interesting connections to neurodegeneration:

  • Alzheimer's disease correlation:

    • RNF182 is upregulated in post-mortem AD brain tissue compared to age-matched controls

    • Quantitative RT-PCR analysis confirmed higher RNF182 transcript levels in AD brains

  • Cellular stress response:

    • RNF182 expression increases in post-mitotic NT2 neurons subjected to oxygen and glucose deprivation (OGD)

    • After 2h OGD treatment (10-15% cell death) and 16h recovery (35-40% cell death), RNF182 mRNA was significantly upregulated

    • When β-amyloid peptide was added during OGD treatment (increasing cell death to 55-60%), RNF182 expression doubled

  • Effect on cell viability:

    • Overexpression of RNF182 in N2a cells triggers cell death compared to mock transfection

    • Conversely, downregulation of endogenous RNF182 using siRNAs significantly reduced cell death caused by OGD treatment

These findings suggest RNF182 plays a role in neurodegeneration and could be a target for neuroprotective interventions.

How does RNF182 regulate immune responses?

RNF182 has been identified as a negative regulator of immune responses:

  • It is highly expressed in macrophages and upregulated by TLR stimuli (TLR4, TLR3, and TLR9 agonists)

  • RNF182 promotes the degradation of p65 (a component of NF-κB) via K48-linked ubiquitination

  • Knockdown of RNF182 amplifies TLR signaling by enhancing production of proinflammatory cytokines

  • This negative feedback mechanism helps terminate TLR-induced inflammation and maintain immunological balance

What are the challenges in determining the complete interactome of RNF182 in Xenopus laevis?

Determining the complete RNF182 interactome faces several challenges:

  • Low endogenous expression levels:

    • RNF182 is weakly expressed and not detectable by Northern blotting

    • Special techniques like quantitative RT-PCR are needed to detect expression changes

  • Transient interactions:

    • E3 ubiquitin ligases often interact transiently with their substrates

    • The ubiquitination process leads to substrate degradation, making stable interactions difficult to capture

  • Substrate-independent activity:

    • RNF182 exhibits substrate-independent, E2-dependent assembly of multi-ubiquitin chains

    • This complicates the identification of specific physiological substrates

  • Technical limitations:

    • The allotetraploid genome of Xenopus laevis complicates genetic studies

    • Alternative transcript variants exist, with two splice variants arising from exon swapping

How can CRISPR/Cas9 genome editing be used to study RNF182 function in Xenopus?

CRISPR/Cas9 technology has been successfully applied in Xenopus systems and can be used to study RNF182:

  • Design of guide RNAs:

    • Target specific regions of the RNF182 gene

    • For functional studies, target the RING finger domain (between amino acids C20 and C67)

  • Delivery methods:

    • Microinjection of Cas9 protein and gRNA into fertilized eggs

    • Injection at the one-cell stage for whole-organism knockouts

    • Targeted injections at later stages for tissue-specific effects

  • Verification of edits:

    • T7 endonuclease assay or sequencing to confirm mutations

    • RT-PCR and Western blotting to verify expression changes

  • Phenotypic analysis:

    • Since RNF182 is brain-enriched, focus on neural development and function

    • Assess effects on cell viability and response to stress conditions

    • Examine potential impacts on immune regulation

This approach has been demonstrated in Xenopus tropicalis, where mutations in noggin were successfully induced using zinc-finger nucleases . Similar approaches would be applicable to RNF182.

What is the potential role of RNF182 in regulating PDL1 expression and cancer immunology?

Recent research has revealed a potential connection between RNF182 and cancer immunology:

  • RNF182 induces p65 ubiquitination, which affects PDL1 transcription

  • In lung adenocarcinoma (LUAD), RNF182 expression is decreased

  • RNF182 expression correlates with advanced TNM and clinical stages in LUAD

  • Lower RNF182 expression is associated with T2-T4 stages, N1-N2 stages, and M1 stage

This suggests RNF182 may play a role in cancer progression through immune regulation, representing a potential area for further study in Xenopus cancer models.

How can structural studies of Xenopus RNF182 inform therapeutic design?

Structural studies of Xenopus RNF182 could provide valuable insights for therapeutic development:

  • Key structural features to analyze:

    • The C3HC4-type RING finger domain (amino acids C20-C67)

    • Two putative transmembrane helices at the C-terminus

    • Four leucine repeats between amino acids 197-225

  • Comparative structural analysis:

    • Human RNF182 is highly homologous to rodent versions (98% and 97% sequence identity to mouse and rat)

    • Comparative analysis with Xenopus RNF182 could reveal conserved functional domains

  • Structure-function relationships:

    • Determine which domains are essential for:

      • E3 ligase activity

      • Substrate binding (the RING finger domain does not appear to mediate ATP6V0C interaction)

      • Cellular localization

  • Therapeutic implications:

    • Since RNF182 affects cell viability and is upregulated in neurodegeneration, inhibitors could have neuroprotective effects

    • Its role in immune regulation suggests potential applications in inflammatory conditions

Understanding these structural aspects could guide the design of small molecules targeting specific RNF182 functions while sparing others.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.