Recombinant Xenopus laevis E3 ubiquitin-protein ligase synoviolin A (syvn1-a)

Shipped with Ice Packs
In Stock

Description

Functional Role in Ubiquitination and ER-Associated Degradation (ERAD)

Syvn1-a functions as an E3 ubiquitin ligase within the ERAD pathway, a system that identifies and degrades misfolded ER proteins. Its enzymatic activity involves:

  • Substrate Recognition: Accepts ubiquitin from the E2 ligase UBC7, facilitating substrate polyubiquitination .

  • Mechanism: Transfers ubiquitin to target proteins via its RING domain, marking them for proteasomal degradation .

  • Key Targets: Includes misfolded ER proteins, peroxisome proliferator-activated receptor coactivator (PGC)-1β, and regulators of mitochondrial biogenesis .

Metabolic Regulation

  • Body Weight Control: Global knockout of Syvn1 in mice reduces white adipose tissue (WAT) mass by 50% and increases mitochondrial biogenesis via PGC-1β stabilization .

  • PGC-1β Ubiquitination: Syvn1-a directly ubiquitinates PGC-1β, a transcriptional coactivator of mitochondrial genes, reducing its half-life from 4.5 hours to 2.5 hours .

Therapeutic Implications

  • Obesity Intervention: Inhibition of syvn1-a with LS-102 increases energy expenditure and prevents diet-induced obesity in murine models .

  • Disease Associations: Dysregulation of syvn1-a is linked to arthritis, fibrosis, and neurodegenerative disorders due to its role in ER stress mitigation .

Experimental Applications

Recombinant syvn1-a is widely used in:

  • Ubiquitination Assays: In vitro studies to identify novel substrates (e.g., PGC-1β) .

  • Drug Discovery: Screening inhibitors like LS-102 for metabolic or inflammatory diseases .

  • Structural Studies: Mapping interaction domains (e.g., SyU domain for PGC-1β binding) .

Comparison of syvn1-a Isoforms

IsoformGene NameTissue ExpressionFunctional Differences
syvn1-asyvn1.LUbiquitousPrimary regulator of PGC-1β degradation
syvn1-bsyvn1.SLimitedLess studied; potential redundancy

Key Research Studies

Study FocusKey FindingsCitation
Metabolic regulationSyvn1-a deficiency increases mitochondrial respiration by 40% in adipose tissue
Substrate specificitySyvn1-a ubiquitinates PGC-1β but not PGC-1α, highlighting isoform selectivity
Therapeutic targetingLS-102 inhibits syvn1-a, reducing obesity in mice without adverse effects

Future Directions

Current research aims to:

  • Identify additional syvn1-a substrates in non-mammalian models like Xenopus .

  • Develop tissue-specific syvn1-a inhibitors to minimize off-target effects .

  • Explore roles in neurodegeneration, given its ability to degrade polyglutamine-expanded huntingtin .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will fulfill your requests if possible.
Lead Time
Delivery time may vary depending on the purchase method or location. Please contact your local distributors for specific delivery time information.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, we recommend briefly centrifuging the vial to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquotation for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference for your own adjustments.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's intrinsic stability.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
We will determine the tag type during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
syvn1-a; hrd1-a; E3 ubiquitin-protein ligase synoviolin A; RING-type E3 ubiquitin transferase synoviolin A; Synovial apoptosis inhibitor-1-A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
17-605
Protein Length
Full Length of Mature Protein
Species
Xenopus laevis (African clawed frog)
Target Names
syvn1-a
Target Protein Sequence
YYLKNQFYPTVVYLTKSSPSMAVLYIQAFVLVFLLGKFMGKVFFGQLRAAEMEHLLERSW YAVTETCLAFTVFRDDFSPRFVALFTLLLFLKCFHWLAEDRVDFMERSPNISWLFHFRIL ALMLLLGVLDAFFVSHAYHSLVIRGASVQLVFGFEYAILMTVILTVFIKYILHSVDLQSE NPWDNKAVYMLYTELFTGFIKVLLYVAFMTIMVKVHTFPLFAIRPMYLAMRQFKKAVTDA IMSRRAIRNMNTLYPDATAEELQAMDNVCIICREEMVTGAKRLPCNHIFHTSCLRSWFQR QQTCPTCRMDVLRASLPTQPQTPTEQQNQHQNQAQQQPTPVIPPQPNFPPGILPPFPPGM FPLWPPMGPFPPVPGAPGGNPPDEANPGSSSGSSPRPGETSNVGSESQPGAALPGFPFPP PFLGMPILPPFGLPPMPMPPAGFTGLTDEELRAMEGHERQNLEARLQCLQNIHTLLDAAM LQINQYLTVLASIGPPQPPISSTSTSTSSAASASTAPTTSNISEPVIPVDTTSTVTNTES SQQSAPPAPVSVETLSGAEGGETTTEEPDNVELRRRRLQKLETGTTDSQ
Uniprot No.

Target Background

Function
E3 ubiquitin-protein ligase that accepts ubiquitin specifically from endoplasmic reticulum-associated UBC7 E2 ligase and transfers it to substrates, promoting their degradation. As a component of the endoplasmic reticulum quality control (ERQC) system, also known as ER-associated degradation (ERAD), it is involved in the ubiquitin-dependent degradation of misfolded endoplasmic reticulum proteins. It also promotes the degradation of normal but naturally short-lived proteins. This ligase protects cells from ER stress-induced apoptosis. It sequesters p53 in the cytoplasm and promotes its degradation, thereby negatively regulating its biological functions in transcription, cell cycle regulation, and apoptosis.
Database Links

KEGG: xla:431869

UniGene: Xl.18945

Protein Families
HRD1 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is Xenopus laevis E3 ubiquitin-protein ligase synoviolin A (syvn1-a)?

Syvn1-a (synoviolin 1) is an E3 ubiquitin ligase that accepts ubiquitin specifically from endoplasmic reticulum-associated UBC7 E2 ligase and transfers it to various substrate proteins, promoting their degradation. It functions as a component of the endoplasmic reticulum and plays critical roles in protein quality control and ER homeostasis . The protein is also known by several synonyms including hrd1 and functions within the larger context of the endoplasmic reticulum-associated degradation (ERAD) pathway that helps maintain cellular proteostasis.

What are the alternative names and synonyms for syvn1-a?

Syvn1-a is known by several alternative names in the scientific literature:

  • Synoviolin 1 (primary name)

  • hrd1 (homolog of yeast Hrd1p)

  • syvn1-a (species-specific paralog in Xenopus)

  • syvn1-b (another paralog in Xenopus)

These various nomenclatures reflect both the evolutionary conservation of this protein across species and its functional characterization in different model systems. When searching literature, researchers should use multiple name variants to ensure comprehensive results.

What are the known cellular functions of syvn1?

Syvn1 serves multiple critical functions in cellular biology:

  • Protein quality control - As an E3 ubiquitin ligase, it targets misfolded proteins for degradation through the ERAD pathway

  • Regulation of ER morphology - SYVN1 regulates endoplasmic reticulum shape through ubiquitination of atlastins (ATLs), particularly ATL1

  • Metabolic regulation - Syvn1 negatively regulates PGC-1β, a transcriptional coactivator involved in energy metabolism

  • COPII export regulation - It influences protein trafficking from the ER through regulating COPII vesicle formation

  • Mitochondrial activity modulation - Through its interaction with PGC-1β, Syvn1 influences mitochondrial biogenesis and function

The multifaceted roles of syvn1 highlight its importance in maintaining cellular homeostasis through protein quality control and organelle dynamics.

How does syvn1 regulate endoplasmic reticulum morphology?

Syvn1 regulates ER morphology through a substrate-specific ubiquitination mechanism. Research demonstrates that SYVN1 specifically targets atlastins (ATLs), particularly ATL1, which are dynamin-like GTPases responsible for mediating homotypic membrane fusion in the ER network . This regulation occurs through these specific steps:

  • SYVN1 directly interacts with ATL1 as demonstrated by co-immunoprecipitation studies

  • It catalyzes the ubiquitination of ATL1 primarily at lysine 285 (K285) and to a lesser extent at K287

  • This ubiquitination does not lead to ATL1 degradation but rather inhibits its GTPase activity

  • Inhibition of ATL1 GTPase activity reduces its capacity to mediate ER membrane fusion

  • Consequently, SYVN1 overexpression disrupts normal ER network structure, while SYVN1 depletion leads to hyperfusion

When researchers experimentally knocked down both SYVN1 and ATL1, they observed partial recovery of normal ER structure, confirming that SYVN1 regulates ER morphology primarily through ATL1 ubiquitination . The RING domain of SYVN1 is essential for this function, as demonstrated by the C329S mutant's inability to disrupt ER morphology .

What is the relationship between syvn1 and energy metabolism?

Syvn1 plays a significant role in regulating energy metabolism through its interaction with PGC-1β (peroxisome proliferator-activated receptor gamma coactivator 1-beta). Research findings demonstrate:

  • Syvn1 directly interacts with PGC-1β through a specific domain (aa 195-367 of PGC-1β) containing an LXXLL motif

  • This interaction was confirmed through multiple approaches:

    • GST pull-down assays

    • Co-immunoprecipitation of tagged proteins

    • Immunoprecipitation of endogenous proteins

  • Syvn1 functions as an E3 ubiquitin ligase for PGC-1β, as demonstrated by:

    • In vitro ubiquitination assays showing polyubiquitination of PGC-1β in the presence of ATP, HA-Ub, E1, E2, and SYVN1

    • In vivo ubiquitination assays showing that wild-type SYVN1, but not ligase-inactive SYVN1 (3S mutant), mediates PGC-1β ubiquitination

  • This ubiquitination negatively regulates PGC-1β's coactivator function:

    • Knockdown of Syvn1 enhances PPARα-mediated transcription in a PGC-1β-dependent manner

    • Overexpression of SYVN1 inhibits the coactivator function of PGC-1β

The physiological significance of this regulation is evident in Syvn1-deficient mice, which exhibit reduced body weight and decreased white adipose tissue (WAT), despite normal or increased food intake . These mice also show increased mitochondrial activity, consistent with enhanced PGC-1β function when released from SYVN1-mediated negative regulation.

How do ubiquitination patterns by syvn1 determine substrate fate?

Syvn1 demonstrates remarkable specificity in how it targets different substrates for either degradation or functional modification, representing a sophisticated regulatory mechanism:

  • Degradative ubiquitination:

    • Traditional ERAD substrates receive K48-linked polyubiquitin chains, marking them for proteasomal degradation

    • This pathway helps clear misfolded proteins from the ER lumen and membrane

  • Non-degradative ubiquitination:

    • Certain substrates like ATL1 are ubiquitinated by SYVN1 but not degraded

    • ATL1 is ubiquitinated primarily at K285 (and secondarily at K287)

    • This modification inhibits ATL1's GTPase activity rather than triggering degradation

  • Regulatory ubiquitination:

    • PGC-1β is ubiquitinated by SYVN1, which inhibits its coactivator function

    • This represents another regulatory mechanism distinct from protein degradation

The specificity of these different ubiquitination patterns depends on several factors:

  • Substrate binding domains within SYVN1 (such as the SyU domain for PGC-1β)

  • The specific lysine residues targeted on the substrate

  • The ubiquitin chain linkage type (K48, K63, etc.)

  • The presence of cofactors and adaptor proteins that facilitate substrate recognition

This substrate-specific ubiquitination allows SYVN1 to perform diverse cellular functions beyond simple protein quality control.

What are the methods for generating syvn1 knockout models?

Researchers have successfully developed several approaches for generating syvn1 knockout models, particularly in mice. Based on published methodologies, the following comprehensive protocol can be implemented:

  • Targeting construct design:

    • Clone the mouse Syvn1 locus from a BAC clone

    • Design a targeting construct with loxP sites flanking essential exons

    • Include a neomycin selection cassette flanked by Frt recombination sites

    • Linearize the construct before transfection

  • ES cell targeting:

    • Introduce the linearized construct into embryonic stem (ES) cells via electroporation

    • Select recombinant ES cell clones expressing the neomycin gene using G418-supplemented medium

    • Confirm proper recombination by PCR and Southern blotting

    • Inject successful recombinant ES cells into C57BL/6 mouse-derived blastocysts

  • Mouse breeding strategy:

    • Cross chimeric mice with FLP deleter strain to remove the neomycin selection cassette

    • Generate floxed heterozygous Syvn1ᶠˡᵒˣ/⁺ mice

    • Cross with Cre-expressing lines for specific knockout approaches:

      • For inducible global knockout: Cross with CAG-Cre-ER mice

      • For tissue-specific knockout: Cross with tissue-specific Cre lines (e.g., Adipoq-Cre for adipose-specific deletion)

  • Validation of knockout efficiency:

    • Confirm recombination at genomic level by PCR

    • Measure mRNA reduction by real-time PCR

    • Verify protein depletion by Western blotting

This methodology has been successfully implemented to generate conditional Syvn1 knockout mice that showed significant phenotypes including reduced body weight and altered metabolism, confirming the critical role of Syvn1 in vivo .

What assays can be used to measure syvn1 ubiquitin ligase activity?

Several robust assays can be employed to measure syvn1 ubiquitin ligase activity in different experimental contexts:

  • In vitro ubiquitination assay:

    • Components: Purified recombinant syvn1, E1 enzyme, E2 enzyme (UBC7/UBE2G2), ATP, ubiquitin, and substrate protein

    • Detection: Western blotting with antibodies against the substrate or against ubiquitin

    • Analysis: Appearance of higher molecular weight bands indicating ubiquitinated forms of the substrate

  • Cell-based ubiquitination assay:

    • Transfect cells with tagged versions of syvn1, ubiquitin, and the substrate of interest

    • Immunoprecipitate the substrate under denaturing conditions

    • Detect ubiquitination by immunoblotting with anti-ubiquitin or anti-tag antibodies

    • Compare wild-type syvn1 with catalytically inactive mutants (e.g., SYVN1 C329S or SYVN1 3S)

  • Substrate-specific activity assays:

    • For ATL1: Measure GTPase activity of ATL1 in the presence and absence of syvn1

    • For PGC-1β: Use reporter assays with PPARα response elements to assess coactivator function

  • ERAD efficiency assay:

    • Monitor degradation rates of known ERAD substrates with cycloheximide chase

    • Compare degradation kinetics in the presence and absence of syvn1

    • Quantify protein levels by Western blotting at different time points

  • Domain mutant analysis:

    • Generate specific domain mutants (e.g., RING domain mutant C329S)

    • Compare ubiquitination activity between wild-type and mutant syvn1

These complementary approaches provide a comprehensive assessment of syvn1 ligase activity, substrate specificity, and the functional consequences of ubiquitination in different experimental systems.

What techniques are available for identifying new substrates of syvn1?

Researchers can employ several advanced techniques to identify novel substrates of syvn1:

  • Proteomics-based approaches:

    • Stable Isotope Labeling with Amino acids in Cell culture (SILAC) combined with ubiquitin enrichment

    • Compare ubiquitinomes of wild-type vs. syvn1-knockout or knockdown cells

    • Identify proteins with decreased ubiquitination in syvn1-deficient cells

  • Proximity labeling techniques:

    • BioID or TurboID fused to syvn1 to biotinylate proximal proteins

    • APEX2-based proximity labeling

    • Mass spectrometry analysis of biotinylated proteins to identify potential substrates

  • Yeast two-hybrid screening:

    • Use different domains of syvn1 as bait to identify interacting proteins

    • Validate interactions with co-immunoprecipitation and in vitro binding assays

    • Test identified interactors as potential ubiquitination substrates

  • Protein microarrays:

    • Perform in vitro ubiquitination reactions on protein microarrays

    • Detect ubiquitination using fluorescently labeled ubiquitin or anti-ubiquitin antibodies

    • Identify proteins showing syvn1-dependent ubiquitination

  • Genetic screens:

    • Conduct synthetic lethality screens with syvn1 mutants

    • Perform CRISPR screens to identify genes that modify syvn1-related phenotypes

  • Domain-based prediction:

    • Identify proteins containing known syvn1 substrate recognition motifs

    • For example, proteins with LXXLL motifs similar to PGC-1β

  • Validation strategies:

    • Confirm direct interactions using co-immunoprecipitation of endogenous proteins

    • Perform in vitro and in vivo ubiquitination assays

    • Map ubiquitination sites using mass spectrometry

    • Determine functional consequences of ubiquitination (degradation vs. functional modification)

Recent studies have successfully employed these approaches to identify ATL1 and PGC-1β as physiologically relevant substrates of syvn1, demonstrating the efficacy of these methods in expanding our understanding of syvn1's functional network.

What is the role of syvn1 in metabolic disorders?

Syvn1 plays a significant role in metabolic regulation and has been implicated in metabolic disorders through several mechanisms:

  • Body weight regulation:

    • Syvn1-deficient mice (CAG-Cre-ER;Syvn1ᶠˡᵒˣ/ᶠˡᵒˣ) exhibit significant weight loss after Tam administration

    • These mice maintain only approximately 80% of the body weight of control mice

    • Even heterozygous Syvn1 deletion (CAG-Cre-ER;Syvn1ᶠˡᵒˣ/⁺) results in slight weight decrease

  • Adipose tissue regulation:

    • Anatomical analysis shows marked reduction in white adipose tissue (WAT) in Syvn1-deficient mice

    • This effect occurs despite normal or even increased food intake in these animals

    • Syvn1 appears to regulate adipose tissue mass independent of appetite or food consumption

  • Molecular mechanisms:

    • Syvn1 negatively regulates PGC-1β, a critical transcriptional coactivator in energy metabolism

    • This interaction occurs through the aa 195-367 region of PGC-1β containing an LXXLL motif

    • Syvn1 ubiquitinates PGC-1β and inhibits its coactivator function

  • Mitochondrial regulation:

    • Syvn1 knockdown leads to increased mitochondrial biogenesis

    • Cells treated with Syvn1 siRNA contain larger numbers of mitochondria compared to control siRNA

    • This effect is not observed when both Syvn1 and PGC-1β are knocked down, indicating PGC-1β dependence

  • Transcriptional effects:

    • Syvn1 knockdown enhances PPARα-mediated transcription in a PGC-1β-dependent manner

    • This effect is observed using reporter assays with PPAR response elements

The connection between Syvn1 and metabolic regulation has been further supported by studies involving metabolic disease models, including interactions with leptin-deficient (ob/ob) and leptin receptor-deficient (db/db) mice . These findings suggest that modulating Syvn1 activity could represent a potential therapeutic approach for certain metabolic disorders.

How does syvn1 contribute to ER-stress related pathologies?

Syvn1 plays a crucial role in ER homeostasis and stress responses, with significant implications for various pathological conditions:

  • ER morphology regulation:

    • SYVN1 regulates ER shape through ubiquitination of atlastins (ATLs), particularly ATL1

    • SYVN1 overexpression disrupts normal ER network structure

    • This morphological regulation affects ER function and stress responses

  • ERAD pathway function:

    • As a key E3 ligase in the ERAD pathway, SYVN1 helps clear misfolded proteins from the ER

    • SYVN1 functions in parallel with other E3 ligases like AMFR during ERAD

    • Impairment of SYVN1 function can lead to accumulation of misfolded proteins and ER stress

  • Protein trafficking regulation:

    • SYVN1 regulates COPII export from the ER

    • Disruption of this function affects protein secretion and membrane protein delivery

    • This may contribute to pathologies involving secretory or membrane proteins

  • Connection to neurodegenerative diseases:

    • ATL1 defects lead to hereditary spastic paraplegia (HSP), a neurodegenerative disease

    • SYVN1 regulates ATL1 function through ubiquitination at K285 and K287

    • This suggests SYVN1 may indirectly contribute to neurodegenerative processes

  • Metabolic stress response:

    • Through regulation of PGC-1β, SYVN1 influences cellular metabolic responses

    • This connection links ER stress to broader metabolic dysfunction

    • Therapeutic targeting of this pathway could address both ER stress and metabolic pathologies

The multifaceted roles of SYVN1 in ER homeostasis, protein quality control, and organelle morphology make it a significant factor in diseases characterized by ER stress, protein misfolding, and metabolic dysfunction. Understanding these mechanisms provides potential targets for therapeutic intervention in conditions ranging from neurodegenerative diseases to metabolic disorders.

How can recombinant syvn1-a be expressed and purified for in vitro studies?

For researchers working with Xenopus laevis E3 ubiquitin-protein ligase synoviolin A, an optimized protocol for recombinant expression and purification includes:

  • Expression system selection:

    • Bacterial systems (E. coli):

      • Best for truncated versions lacking transmembrane domains

      • Use strains optimized for eukaryotic protein expression (e.g., BL21-CodonPlus, Rosetta)

      • Consider fusion tags (MBP, SUMO) to enhance solubility

    • Insect cell systems:

      • Preferred for full-length or membrane-containing constructs

      • Baculovirus expression system provides better post-translational modifications

      • Use Sf9 or Hi5 cells for higher expression levels

  • Construct design considerations:

    • For functional studies, include the RING domain (containing the catalytic C329 residue)

    • For membrane-free constructs, exclude the transmembrane domains

    • Consider adding affinity tags (His, GST, FLAG) for purification

    • Include protease cleavage sites between the tag and protein

  • Purification strategy:

    • For His-tagged constructs:

      • Immobilized metal affinity chromatography (IMAC) using Ni-NTA or Co-based resins

      • Include imidazole in wash buffers to reduce non-specific binding

    • For GST-tagged constructs:

      • Glutathione Sepharose affinity purification

      • Consider on-column tag cleavage to improve purity

    • Secondary purification:

      • Ion exchange chromatography based on theoretical pI

      • Size exclusion chromatography for final polishing and buffer exchange

  • Buffer optimization:

    • Include reducing agents (DTT or TCEP) to maintain cysteine residues in RING domain

    • Consider detergents for membrane-containing constructs

    • Optimize salt concentration to maintain stability without interfering with activity

    • Include glycerol (10-20%) to improve stability during storage

  • Activity verification:

    • In vitro auto-ubiquitination assay to confirm catalytic activity

    • Substrate-specific ubiquitination assays using known targets (ATL1, PGC-1β)

    • Thermal shift assays to verify proper folding and stability

  • Storage considerations:

    • Flash freeze in liquid nitrogen and store at -80°C

    • Test activity after freeze-thaw to ensure functionality is maintained

    • Consider adding protease inhibitors to prevent degradation

This comprehensive approach allows for the production of functionally active recombinant syvn1-a suitable for various biochemical and structural studies, including substrate identification, mechanism elucidation, and inhibitor screening.

What are the critical controls needed when studying syvn1-substrate interactions?

When investigating syvn1-substrate interactions, researchers must implement rigorous controls to ensure reliable and meaningful results:

  • Protein-protein interaction controls:

    • Negative controls:

      • Use of non-interacting proteins (e.g., GST alone in pull-down assays)

      • Immunoprecipitation with non-immune IgG instead of specific antibodies

    • Specificity controls:

      • Test interaction with related E3 ligases (e.g., AMFR as used in comparative studies)

      • Domain mapping to identify specific interaction regions (as shown for PGC-1β)

    • Validation across methods:

      • Confirm interactions using multiple approaches (e.g., co-IP, GST pull-down, proximity labeling)

      • Demonstrate interactions at both endogenous and overexpressed protein levels

  • Ubiquitination assay controls:

    • Enzymatic activity controls:

      • Include catalytically inactive syvn1 mutants (C329S or 3S mutants)

      • Omit critical components (ATP, E1, E2) as negative controls

    • Substrate specificity controls:

      • Test non-substrate proteins in parallel

      • Use substrate mutants lacking ubiquitination sites (e.g., K285R/K287R for ATL1)

    • Functional consequence controls:

      • Distinguish between degradative and non-degradative ubiquitination

      • Include proteasome inhibitors to determine if ubiquitination leads to degradation

  • Functional validation controls:

    • For ATL1-syvn1 interaction:

      • Measure GTPase activity with wild-type and ubiquitination-resistant ATL1

      • Assess ER morphology with various constructs and knockdowns

    • For PGC-1β-syvn1 interaction:

      • Use reporter assays with PPARα response elements

      • Compare effects of wild-type vs. interaction-deficient mutants (e.g., R266A/R267A)

  • In vivo relevance controls:

    • Genetic rescue experiments:

      • Knockdown both syvn1 and substrate to demonstrate pathway specificity

      • Rescue phenotypes with wild-type but not mutant constructs

    • Tissue-specific studies:

      • Compare different conditional knockout models (e.g., global vs. tissue-specific)

      • Correlate biochemical findings with physiological outcomes

  • Technical controls:

    • Expression level controls:

      • Ensure comparable expression levels between wild-type and mutant proteins

      • Include input controls for all interaction experiments

    • Cross-reactivity controls:

      • Validate antibody specificity using knockout or knockdown samples

      • Include epitope tag controls when using tagged constructs

Implementing these comprehensive controls ensures robust and reproducible findings when investigating syvn1-substrate interactions, allowing for confident interpretation of results and reducing the risk of experimental artifacts.

How can one distinguish between the roles of syvn1-a versus syvn1-b in Xenopus?

Distinguishing between the paralogs syvn1-a and syvn1-b in Xenopus requires a multifaceted approach combining molecular, genetic, and functional techniques:

  • Sequence-based differentiation:

    • Multiple sequence alignment to identify paralog-specific regions

    • Design of paralog-specific PCR primers and probes

    • Utilization of unique restriction sites for restriction fragment length polymorphism (RFLP) analysis

  • Expression pattern analysis:

    • Paralog-specific qRT-PCR to quantify relative expression levels in different tissues

    • In situ hybridization with paralog-specific probes to visualize tissue distribution

    • RNA-seq analysis comparing expression across developmental stages and tissues

    • Western blotting with paralog-specific antibodies if epitope differences allow

  • Genetic manipulation approaches:

    • Paralog-specific morpholino antisense oligonucleotides for targeted knockdown

    • CRISPR-Cas9 gene editing targeting unique sequences in each paralog

    • Rescue experiments with paralog-specific constructs to test functional redundancy

  • Biochemical characterization:

    • Recombinant expression of each paralog for in vitro activity assays

    • Substrate specificity assays comparing ubiquitination targets between paralogs

    • Co-immunoprecipitation studies to identify paralog-specific interacting partners

    • Mass spectrometry to identify differences in post-translational modifications

  • Developmental function analysis:

    • Time-course studies of developmental defects following paralog-specific knockdown

    • Comparative phenotypic analysis of single and double paralog knockdowns

    • Tissue-specific rescue experiments to map functional domains

  • Evolutionary context:

    • Comparative analysis with single-copy orthologs in other species

    • Synteny analysis to determine origin of gene duplication

    • Selection pressure analysis to identify divergent versus conserved domains

This comprehensive approach allows researchers to differentiate between the potentially overlapping yet distinct functions of syvn1-a and syvn1-b in Xenopus, providing insights into functional divergence following gene duplication and the specific roles of each paralog in development and cellular homeostasis.

How do syvn1 interactions with ATLs impact cellular stress responses?

The interaction between syvn1 and atlastins (ATLs) represents a critical regulatory mechanism affecting cellular stress responses through multiple pathways:

  • ER network integrity regulation:

    • SYVN1 ubiquitinates ATL1 at specific lysine residues (K285 and K287)

    • This ubiquitination inhibits ATL1 GTPase activity rather than causing degradation

    • The resulting modulation of ER membrane fusion directly impacts ER network morphology

    • Disrupted ER morphology affects the cell's capacity to handle various stressors

  • Protein trafficking modulation:

    • SYVN1 regulates COPII export mechanisms partly through its effects on ATLs

    • This impacts protein secretion efficiency and ER-to-Golgi trafficking

    • During stress conditions, this regulation may prioritize specific protein transport pathways

  • Integration with unfolded protein response (UPR):

    • ER morphology changes mediated by SYVN1-ATL interactions influence UPR signaling

    • Expanded ER surface area can enhance protein folding capacity

    • Changes in ER-mitochondria contact sites affect calcium signaling and apoptotic thresholds

  • Implications for neurodegenerative disease:

    • ATL1 mutations cause hereditary spastic paraplegia (HSP)

    • SYVN1 regulation of ATL1 may represent a potential therapeutic target for HSP

    • The non-degradative ubiquitination mechanism offers opportunities for specific intervention

  • Cross-talk with metabolic stress pathways:

    • ER morphology changes affect lipid metabolism and trafficking

    • This links SYVN1-ATL interactions to the cell's metabolic stress response capabilities

    • Combined with SYVN1's role in regulating PGC-1β , this creates a coordinated stress response system

Future research directions should focus on how this regulatory mechanism responds to different cellular stressors, how it integrates with other stress response pathways, and whether it can be therapeutically targeted in diseases characterized by ER dysfunction or altered proteostasis.

What are the emerging therapeutic applications targeting syvn1 function?

Based on the expanding understanding of syvn1's roles in cellular homeostasis, several promising therapeutic applications are emerging:

  • Metabolic disorder interventions:

    • Syvn1 inhibition could enhance PGC-1β activity, promoting mitochondrial biogenesis

    • Experimental data shows Syvn1-deficient mice have reduced body weight despite normal food intake

    • This suggests potential applications in obesity and metabolic syndrome

    • Small molecule inhibitors targeting the RING domain could modulate Syvn1 activity

  • Neurodegenerative disease approaches:

    • Modulating Syvn1-ATL1 interactions could benefit hereditary spastic paraplegia patients

    • SYVN1 regulates ATL1 through non-degradative ubiquitination at K285/K287

    • Targeted disruption of this specific interaction while preserving other SYVN1 functions could be therapeutic

    • Peptide-based inhibitors mimicking the ATL1 interaction surface represent a possible approach

  • ER stress-related conditions:

    • Fine-tuning SYVN1 activity could enhance cellular resilience to ER stress

    • This has implications for diseases characterized by protein misfolding

    • Substrate-specific modulators could allow precise control of SYVN1 functions

  • Protein quality control enhancement:

    • Activating specific SYVN1 ERAD functions could help clear disease-associated misfolded proteins

    • This approach differs from general SYVN1 inhibition by focusing on specific substrate pathways

    • Structure-based drug design targeting substrate-binding domains could achieve specificity

  • Diagnostic and prognostic applications:

    • SYVN1 activity or expression levels may serve as biomarkers for disease states

    • Monitoring SYVN1-mediated ubiquitination patterns could provide insights into disease progression

    • Development of activity-based probes could facilitate personalized medicine approaches

These emerging therapeutic directions highlight the potential clinical significance of basic research on syvn1 function and regulation. The diverse cellular roles of syvn1 offer multiple intervention points, while also requiring careful consideration of specificity to avoid disrupting essential cellular functions.

What are the most significant unresolved questions in syvn1 research?

Despite significant advances in understanding syvn1 biology, several critical knowledge gaps remain:

  • Substrate recognition mechanisms:

    • How does syvn1 distinguish between degradative and non-degradative ubiquitination targets?

    • What determines the specific lysine residues targeted on different substrates?

    • Are there common structural motifs in diverse syvn1 substrates?

  • Regulatory mechanisms:

    • How is syvn1 activity regulated under different cellular stress conditions?

    • What post-translational modifications affect syvn1 function?

    • How do cofactors and adaptors influence substrate selectivity?

  • Paralog-specific functions:

    • What are the distinct roles of syvn1-a versus syvn1-b in Xenopus development and physiology?

    • How have these paralogs functionally diverged following gene duplication?

    • Are there substrate preferences unique to each paralog?

  • Species-specific variations:

    • How conserved are syvn1 functions across vertebrate species?

    • Are there significant differences between amphibian and mammalian syvn1 orthologs?

    • How do these differences inform evolutionary adaptation of ER quality control mechanisms?

  • Pathophysiological roles:

    • What is the significance of syvn1 dysregulation in specific disease states?

    • How does the syvn1-PGC-1β axis contribute to metabolic disorders beyond obesity?

    • Could syvn1-mediated regulation of ER morphology be therapeutically targeted?

Addressing these questions will require innovative approaches combining structural biology, systems-level analysis, and in vivo studies across multiple model organisms. The answers will not only advance our fundamental understanding of ubiquitin biology but also open new avenues for therapeutic intervention in conditions ranging from metabolic disorders to neurodegenerative diseases.

What is the significance of studying syvn1 in Xenopus compared to mammalian systems?

Studying syvn1 in Xenopus laevis offers several distinct advantages and complementary insights compared to mammalian systems:

  • Developmental biology advantages:

    • Xenopus embryos develop externally with large, accessible cells

    • This allows visualization and manipulation of developmental processes in real-time

    • The presence of syvn1 paralogs (syvn1-a and syvn1-b) permits analysis of subfunctionalization

    • External development facilitates assessment of phenotypes that would be embryonic lethal in mammals

  • Evolutionary insights:

    • Amphibians occupy an important phylogenetic position between fish and mammals

    • Comparative analysis across species can reveal conserved versus divergent functions

    • The gene duplication resulting in syvn1-a and syvn1-b provides a natural experiment in protein evolution

    • Identification of conserved domains suggests fundamental functions maintained throughout vertebrate evolution

  • Experimental advantages:

    • Xenopus oocytes and embryos contain large amounts of material for biochemical studies

    • Morpholino knockdown and CRISPR techniques are well-established in this system

    • Microinjection of mRNAs, proteins, or small molecules is straightforward

    • In vitro fertilization provides synchronized developmental staging

  • Unique biological contexts:

    • Metamorphosis represents a dramatic remodeling of tissues with potential regulation by syvn1

    • The distinct metabolism of amphibians may reveal novel aspects of syvn1 function in energy homeostasis

    • Cell type-specific functions can be studied in the context of diverse tissues

  • Translational significance:

    • Conserved mechanisms identified in Xenopus often translate to mammals

    • Novel substrates or regulatory mechanisms discovered in Xenopus can guide mammalian studies

    • The simplified genomic background may reveal functions obscured by redundancy in mammals

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.