Recombinant Xenopus laevis E3 ubiquitin-protein ligase synoviolin B (syvn1-b)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Xenopus laevis E3 Ubiquitin-Protein Ligase Synoviolin B (syvn1-b)

Recombinant Xenopus laevis E3 ubiquitin-protein ligase synoviolin B (syvn1-b) is a synthetic protein derived from the African clawed frog (Xenopus laevis) and produced via bacterial expression systems. It belongs to the synoviolin (SYVN1) family, a group of endoplasmic reticulum (ER)-resident E3 ubiquitin ligases critical for protein quality control and stress response pathways. This recombinant form is engineered for research applications, including enzymatic assays, structural studies, and immunological analyses .

Metabolic Regulation

PGC-1β, a thermogenic coactivator, is a substrate of SYVN1 in mammals. SYVN1-mediated ubiquitination of PGC-1β suppresses mitochondrial biogenesis and energy expenditure. In Syvn1-deficient mice, increased PGC-1β activity correlates with reduced adiposity and enhanced mitochondrial respiration . Recombinant syvn1-b could serve as a tool to study PGC-1β regulation in Xenopus models.

Cancer and Metastasis

In hepatocellular carcinoma (HCC), SYVN1 interacts with HSP90 and regulates EEF2K, a kinase involved in translation elongation. SYVN1 overexpression correlates with metastasis, suggesting its role in tumor progression. The recombinant protein may aid in studying SYVN1’s interaction with HSP90/EEF2K in Xenopus or mammalian systems .

ELISA and Immunological Studies

Recombinant syvn1-b is used in ELISA kits for detecting antibodies or ligase activity. Its His-tag facilitates immobilization on nickel columns for affinity purification .

In Vitro Ubiquitination Assays

Syvn1-b can reconstitute E3 ligase activity in vitro. For example, co-incubation with E1 (ubiquitin-activating enzyme), E2 (UBC7), ubiquitin, and ATP enables polyubiquitination of substrates like PGC-1β or IRE1 .

Obesity and Metabolic Disorders

SYVN1 inhibitors (e.g., LS-102) prevent weight gain in mice by stabilizing PGC-1β. Recombinant syvn1-b could validate SYVN1 as a target for anti-obesity therapies .

Cancer Therapy

In HCC, SYVN1’s interaction with HSP90/EEF2K may disrupt stress tolerance in tumor cells. Syvn1-b-based assays could screen inhibitors targeting this axis .

Neurodegeneration and Stress Response

SYVN1 protects neurons from apoptosis induced by misfolded proteins (e.g., huntingtin). Syvn1-b may model neuroprotective strategies in Xenopus or human cell systems .

Product Specs

Form
Lyophilized powder
Note: While we strive to ship the format currently in stock, we understand your specific needs. Should you have a preference for a particular format, please indicate your requirements when placing the order, and we will accommodate them to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. For precise delivery estimates, please consult your local distributors.
Note: All of our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please contact us in advance as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal stability, store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, it is recommended to briefly centrifuge the vial to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
The shelf life of our products is influenced by several factors including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is essential. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during production. If you have a preferred tag type, please inform us, and we will prioritize its implementation.
Synonyms
syvn1-b; hrd1-b; E3 ubiquitin-protein ligase synoviolin B; RING-type E3 ubiquitin transferase synoviolin B; Synovial apoptosis inhibitor 1-B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
17-595
Protein Length
Full Length of Mature Protein
Species
Xenopus laevis (African clawed frog)
Target Names
syvn1-b
Target Protein Sequence
YYLKNQFYPTVVYLTKSSPSMAILYIQAFVLVFLLGKFMGKVFFGQLRAAEMEHLLERSW YAVTETCLAFTVFRDDFSPRFVALFTLLLFLKCFHWLAEDRVDFMERSPNISWLFHFRIL ALMLLLGVLDAFFVSHAYNSLVTRGASVQLVFGFEYAILMTMILAVFIKYILHSVDLQSE NPWDNKAVYMLYTELFTGFIKVLLYMAFMTIMVKVHTFPLFAIRPMYLAMRQFKKAVTDA VMSRRAIRNMNTLYPDATAEELQAMDNVCIICREEMVSGAKRLPCNHIFHTSCLRSWFQR QQTCPTCRMDVLRASLPTQPQTPAEQQNQHQAQQQPTPVVPPQPNFPPGMLPPFPPGMFP LWPPMGQFPPVPGAPVGNPPDEANPGSSSGSSARAGETSNVGSESHPGAALPGFPFPPPF LGMSILPPFGLPPMPMPPAGFAGLTDEELRAMEGHERQNLEARLQCLQNIHTLLDAAMLQ INQYLTVLASIGPPQPPVSSSSSSSASASTEPTTSSVSEPVIDTSSIVTTDSSQQSASPV PVNVETLGGAEGGETPTEEPDNVELRRRRLQKLETTDSQ
Uniprot No.

Target Background

Function
Recombinant Xenopus laevis E3 ubiquitin-protein ligase synoviolin B (syvn1-b) is an E3 ubiquitin-protein ligase that specifically accepts ubiquitin from the endoplasmic reticulum-associated UBC7 E2 ligase. It then transfers the ubiquitin to substrates, promoting their degradation. Synoviolin B is a crucial component of the endoplasmic reticulum quality control (ERQC) system, also known as ER-associated degradation (ERAD). This system is involved in the ubiquitin-dependent degradation of misfolded endoplasmic reticulum proteins. Synoviolin B also plays a role in the degradation of normal, naturally short-lived proteins. By promoting the degradation of misfolded proteins, synoviolin B protects cells from ER stress-induced apoptosis. Furthermore, it sequesters p53 in the cytoplasm and promotes its degradation, thereby negatively regulating its biological functions in transcription, cell cycle regulation, and apoptosis.
Database Links

KEGG: xla:494996

UniGene: Xl.64351

Protein Families
HRD1 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the basic structure of Xenopus laevis SYVN1-B protein?

Xenopus laevis SYVN1-B is a full-length E3 ubiquitin-protein ligase (Q5XHH7) spanning amino acids 17-595. The mature protein contains multiple transmembrane domains characteristic of ERAD (Endoplasmic Reticulum-Associated Degradation) E3 ligases. The complete amino acid sequence includes characteristic regions for membrane anchoring and catalytic function, with the protein containing 579 amino acids in its mature form. When expressed recombinantly, the protein is often fused to an N-terminal His-tag to facilitate purification and experimental manipulation .

How does SYVN1-B function as an E3 ubiquitin ligase?

SYVN1-B functions as part of the ERAD pathway, targeting misfolded or unassembled proteins for ubiquitination and subsequent proteasomal degradation. Like other E3 ubiquitin ligases, it recognizes specific substrate proteins and facilitates the transfer of ubiquitin from an E2 conjugating enzyme to the substrate. In Xenopus systems, SYVN1-B appears embedded in a high molecular weight complex similar to other E3 ligases like Rmnd5, which enables its recognition and targeting functions . The protein contains the characteristic RING-finger domain necessary for its catalytic activity in facilitating ubiquitin transfer.

What expression systems are optimal for producing recombinant SYVN1-B?

The optimal expression system for Xenopus laevis SYVN1-B is E. coli with His-tag fusion, which allows for efficient purification using affinity chromatography. According to available product information, the full-length mature protein (amino acids 17-595) expresses well in bacterial systems, though careful attention to protein folding is essential due to its transmembrane domains . For functional studies, researchers should consider whether E. coli-expressed protein replicates the native post-translational modifications. Alternative expression systems such as insect cells or mammalian expression systems might be necessary for studies requiring properly folded and modified protein.

What protocols are recommended for reconstitution and storage of recombinant SYVN1-B?

For optimal handling of recombinant SYVN1-B, the following protocol is recommended: The lyophilized protein should be briefly centrifuged prior to opening to ensure all material is at the bottom of the vial. Reconstitution should be performed in deionized sterile water to a final concentration of 0.1-1.0 mg/mL. For long-term storage, adding glycerol to a final concentration of 5-50% (with 50% being optimal) before aliquoting and storing at -20°C/-80°C is recommended. Multiple freeze-thaw cycles should be avoided as they can compromise protein stability and activity. Working aliquots can be stored at 4°C for up to one week .

How can researchers effectively design ubiquitination assays for SYVN1-B?

Designing effective ubiquitination assays for SYVN1-B requires a multi-component system that mimics the ERAD pathway. Researchers should include:

  • Purified recombinant SYVN1-B protein

  • E1 and appropriate E2 conjugating enzymes

  • Ubiquitin (unmodified or tagged for detection)

  • ATP regeneration system

  • Putative substrate proteins

Based on interaction studies similar to those performed with GABA₍A₎α1, co-immunoprecipitation assays can confirm substrate binding before proceeding to ubiquitination studies . For in vitro assays, researchers might begin with known mammalian SYVN1 substrates such as PGC-1β or SIRT2 to test functional conservation. Western blotting with anti-ubiquitin antibodies or using tagged ubiquitin can detect substrate ubiquitination. Including proteasome inhibitors (MG132, Lactacystin) in cellular assays can prevent degradation of ubiquitinated substrates, facilitating their detection .

What approaches can be used to study SYVN1-B knockdown effects in Xenopus systems?

To study SYVN1-B knockdown effects in Xenopus systems, researchers can employ several complementary approaches:

  • Morpholino oligonucleotides: Design antisense morpholinos targeting the translational start site or splice junctions of SYVN1-B mRNA, then inject into Xenopus embryos at early developmental stages.

  • CRISPR/Cas9 genome editing: Design guide RNAs targeting SYVN1-B exons, inject with Cas9 protein or mRNA into fertilized eggs.

  • Adeno-associated virus (AAV) delivery of shRNA: Similar to the approach used with SYVN1 in rodent models, researchers can develop AAV vectors expressing SYVN1-B-specific shRNA for targeted knockdown in tissues of interest .

  • Transgenic approaches: Develop transgenic Xenopus lines with inducible knockdown of SYVN1-B.

When evaluating knockdown effects, researchers should examine developmental phenotypes (particularly in neural tissues, based on studies of related E3 ligases in Xenopus) , changes in ER stress markers (GRP78, CHOP), and stabilization of putative substrate proteins.

How does SYVN1-B contribute to ER stress regulation?

SYVN1-B plays a critical role in ER stress regulation through its function in the ERAD pathway. The protein identifies misfolded proteins in the ER and facilitates their retrotranslocation to the cytosol for proteasomal degradation, helping to maintain ER homeostasis. Studies show that SYVN1 suppresses ER stress through targeted ubiquitination and degradation of specific proteins. For instance, SYVN1 has been demonstrated to ubiquitinate SIRT2, thereby blocking the EMT process in airway epithelial cells, which manifests as reduced expression of ER stress markers including GRP78, GRP94, CHOP, phosphorylated PERK, phosphorylated IRE1, and nuclear ATF6 . This protective mechanism suggests that SYVN1-B in Xenopus may similarly regulate ER stress responses through selective degradation of stress-inducing substrates, though the specific targets may differ between species.

What is the relationship between SYVN1-B and the TGF-β signaling pathway?

SYVN1 exhibits a regulatory relationship with the TGF-β signaling pathway. Research demonstrates that TGF-β1 treatment of bronchial epithelial cells (BEAS-2B) progressively reduces SYVN1 expression in a dose-dependent manner . This reduction appears mechanistically important, as forced overexpression of SYVN1 counteracts TGF-β1-induced changes in epithelial-mesenchymal transition (EMT) markers, including preventing decreases in E-cadherin and increases in Vimentin . In Xenopus systems, while direct evidence for SYVN1-B interaction with TGF-β signaling is limited, the conserved nature of both pathways suggests similar regulatory mechanisms may exist. This relationship is particularly relevant considering the importance of TGF-β signaling in Xenopus embryonic development, especially in processes like neural induction and mesoderm formation where E3 ligase activity has demonstrated roles.

How does SYVN1-B interact with and regulate its substrate proteins?

SYVN1-B, like its mammalian counterpart, regulates substrate proteins through direct interaction, ubiquitination, and targeting for proteasomal degradation. The interaction mechanism involves:

  • Substrate recognition and binding: Co-immunoprecipitation studies with mammalian SYVN1 have demonstrated physical interaction with substrate proteins like GABA₍A₎α1 and SIRT2 . These interactions are specific and lead to functional consequences.

  • Ubiquitination process: After binding, SYVN1 facilitates the transfer of ubiquitin molecules to the substrate, marking it for degradation. This process can be blocked by proteasome inhibitors like MG132 and Lactacystin, which leads to accumulation of the substrate proteins, as demonstrated with GABA₍A₎α1 .

  • Substrate specificity: SYVN1 appears to regulate distinct substrates in different cellular contexts. For example, in adipocytes, it targets PGC-1β for degradation, affecting mitochondrial biogenesis , while in airway cells, it targets SIRT2 .

In Xenopus systems, SYVN1-B likely follows similar mechanisms, though its specific substrate repertoire may differ based on the unique developmental and cellular contexts of amphibian systems.

How does Xenopus laevis SYVN1-B compare to mammalian SYVN1 homologs?

  • Sequence divergence: While the core catalytic domains show high conservation, Xenopus SYVN1-B has unique regions that may confer amphibian-specific functions.

  • Expression patterns: Xenopus E3 ubiquitin ligases like Rmnd5 show strong expression in neuronal ectoderm, prospective brain, eyes, and ciliated skin cells , which may indicate specialized roles in amphibian development not present in mammals.

  • Functional roles: Mammalian SYVN1 has well-documented roles in metabolism through PGC-1β degradation and airway remodeling through SIRT2 regulation . Xenopus SYVN1-B likely shares some of these functions but may have additional roles in amphibian-specific developmental processes.

The differences likely reflect evolutionary adaptations to the unique developmental requirements of amphibians, particularly in embryonic development and metamorphosis.

What other E3 ubiquitin ligases in Xenopus share functional overlap with SYVN1-B?

Several E3 ubiquitin ligases in Xenopus show functional overlap with SYVN1-B, suggesting redundancy or complementary roles in protein quality control and developmental regulation:

  • Rmnd5: This E3 ubiquitin ligase from Xenopus laevis functions as part of a high molecular weight complex similar to SYVN1-B. It shows strong expression in neuronal ectoderm, prospective brain, eyes, and ciliated skin cells. Suppression of Rmnd5 results in malformations of the fore- and midbrain, suggesting crucial roles in neural development .

  • Other ERAD components: The Xenopus genome encodes additional ERAD pathway E3 ligases that likely cooperate with SYVN1-B in maintaining ER homeostasis through slightly different substrate preferences.

  • Developmental regulators: Other E3 ligases involved in embryonic development may complement SYVN1-B functions in specific developmental contexts or tissues.

These overlaps create a network of quality control and regulatory mechanisms that ensure proper protein homeostasis and developmental progression in Xenopus systems.

How has SYVN1 function evolved across vertebrate species?

SYVN1 function shows both conservation and diversification across vertebrate species, reflecting its fundamental role in protein quality control while adapting to species-specific requirements:

  • Core ERAD function: The primary role in ER-associated degradation remains conserved from amphibians to mammals, with SYVN1 serving as a critical E3 ligase for misfolded protein elimination.

  • Species-specific substrates: While some substrates appear conserved (potentially those involved in fundamental cellular processes), others show species-specific targeting. For example, mammalian SYVN1 targets PGC-1β for degradation, affecting mitochondrial biogenesis and metabolism , while Xenopus SYVN1-B may have unique developmental substrates.

  • Tissue-specific functions: In mammals, SYVN1 shows specialized functions in adipocytes for metabolic regulation and in airway cells for protection against remodeling . In Xenopus, E3 ligases show strong expression in neural tissues, suggesting specialized roles in amphibian nervous system development .

  • Developmental timing: The timing and context of SYVN1 activity likely differ between mammals and amphibians, particularly given the unique developmental processes of metamorphosis in Xenopus.

This evolutionary trajectory reflects adaptation of a core cellular quality control mechanism to serve increasingly diverse and specialized functions across vertebrate evolution.

How can researchers effectively use SYVN1-B inhibitors in Xenopus experimental systems?

For researchers working with SYVN1-B inhibitors in Xenopus systems, several methodological considerations are essential:

What methodologies are optimal for identifying novel SYVN1-B substrates in Xenopus systems?

Identifying novel SYVN1-B substrates in Xenopus systems requires a multi-faceted approach:

  • Proteomic analysis after SYVN1-B manipulation:

    • Compare protein abundance in SYVN1-B knockdown vs. control samples using mass spectrometry

    • Enrichment for ubiquitinated proteins using tandem ubiquitin binding entities (TUBEs) before analysis

    • Stable isotope labeling to quantify protein degradation rates with and without SYVN1-B activity

  • Proximity-based labeling approaches:

    • BioID or TurboID fusion with SYVN1-B to identify proximal interacting proteins

    • APEX2 tagging for spatially restricted biotinylation of potential substrates

  • Immunoprecipitation strategies:

    • Co-immunoprecipitation with SYVN1-B followed by mass spectrometry, similar to approaches used to identify GABA₍A₎α1 as a SYVN1 substrate

    • Reverse co-IP using candidate substrates as bait

  • Validation methodologies:

    • Direct ubiquitination assays with recombinant proteins

    • Substrate accumulation after SYVN1-B knockdown or inhibition

    • Half-life determination in the presence/absence of SYVN1-B activity

    • Assessment of substrate levels in different subcellular compartments, particularly intra-ER vs. extra-ER locations

How might SYVN1-B function in Xenopus developmental processes?

SYVN1-B likely plays crucial roles in Xenopus developmental processes through regulated protein degradation at key developmental transitions:

  • Neural development: Based on studies of related E3 ligases like Rmnd5, which show strong expression in neuronal ectoderm, prospective brain, and eyes, SYVN1-B may regulate neural development through targeted degradation of developmental regulators . Suppression of these E3 ligases results in malformations of the fore- and midbrain, suggesting critical developmental functions.

  • Metamorphosis regulation: Given the dramatic tissue remodeling during Xenopus metamorphosis, SYVN1-B may participate in protein quality control during this transition, particularly in the context of thyroid hormone-induced changes.

  • ER stress management during development: As embryonic cells undergo rapid proliferation and differentiation, SYVN1-B likely helps manage increased ER stress through ERAD, similar to how mammalian SYVN1 suppresses ER stress markers like GRP78 and CHOP .

  • TGF-β pathway regulation: SYVN1-B may modulate TGF-β signaling during development, potentially affecting processes like mesoderm induction and neural patterning, analogous to how mammalian SYVN1 interacts with TGF-β1-induced changes .

Future studies could employ tissue-specific knockdown or inhibition of SYVN1-B at different developmental stages to elucidate its precise roles in amphibian development.

What are the major challenges in expressing and purifying functional recombinant SYVN1-B?

Expressing and purifying functional recombinant SYVN1-B presents several technical challenges:

  • Membrane protein solubility: As an ER-resident membrane protein, SYVN1-B contains multiple transmembrane domains that can cause aggregation during expression and purification. To address this, researchers should:

    • Use mild detergents (DDM, CHAPS) during extraction and purification

    • Consider fusion partners that enhance solubility (MBP, SUMO)

    • Optimize buffer conditions with stabilizing agents like glycerol

  • Maintaining native conformation: Preserving the functional structure of SYVN1-B requires:

    • Careful temperature control during purification (4°C)

    • Addition of reducing agents to prevent aberrant disulfide formation

    • Inclusion of protease inhibitors to prevent degradation

  • Yield limitations: E. coli expression systems may produce limited yields due to toxicity or inclusion body formation. Alternative approaches include:

    • Use of specialized E. coli strains designed for membrane proteins

    • Exploration of eukaryotic expression systems (insect cells, Xenopus oocytes)

    • Optimization of induction conditions (lower temperature, reduced IPTG concentration)

  • Functional verification: Confirming that purified SYVN1-B retains catalytic activity requires:

    • Development of robust ubiquitination assays

    • Identification of suitable substrate proteins

    • Verification of complex formation with other ERAD components

How can researchers accurately measure SYVN1-B enzymatic activity?

Accurately measuring SYVN1-B enzymatic activity requires carefully designed assays that capture its E3 ligase function:

  • In vitro ubiquitination assays:

    • Components: Purified SYVN1-B, E1 enzyme, appropriate E2 enzyme, ubiquitin (unmodified or tagged), ATP regeneration system, and substrate protein

    • Detection methods: Western blotting with anti-ubiquitin antibodies, fluorescently labeled ubiquitin, or ELISA-based approaches

    • Controls: Reactions without ATP, without E1/E2, or with catalytically inactive SYVN1-B mutants

  • Cell-based degradation assays:

    • Measure substrate protein half-life in the presence/absence of SYVN1-B

    • Use cycloheximide chase experiments to track protein degradation rates

    • Include proteasome inhibitors (MG132, Lactacystin) as controls to confirm proteasome-dependent degradation

  • ER stress response monitoring:

    • Measure changes in ER stress markers (GRP78, GRP94, CHOP) when SYVN1-B activity is modulated

    • Use reporters for ER stress (e.g., XBP1 splicing assays, ERSE-luciferase constructs)

    • Compare with known ER stress modulators as positive controls

  • Quantitative substrate binding assays:

    • Surface plasmon resonance (SPR) to measure binding kinetics

    • Microscale thermophoresis for interaction analysis

    • Co-immunoprecipitation with quantitative western blotting

A combination of these approaches provides comprehensive assessment of SYVN1-B enzymatic activity in different experimental contexts.

What considerations are important when designing SYVN1-B genetic modifications in Xenopus?

When designing genetic modifications of SYVN1-B in Xenopus systems, researchers should consider:

  • Genomic complexity:

    • Xenopus laevis is allotetraploid with duplicated genes

    • Ensure targeting strategies account for potential paralogs or homeologs

    • Design modifications that target conserved regions across variants

  • Developmental timing:

    • Consider stage-specific requirements when designing conditional modifications

    • Use inducible systems (Tet-On/Off, heat shock, hormone-inducible) for temporal control

    • Monitor effects throughout development, particularly during metamorphosis

  • Technical approaches:

    • Morpholino design: Target translation start sites or splice junctions specific to SYVN1-B

    • CRISPR/Cas9: Design guide RNAs with minimal off-target effects, validate with T7 endonuclease assays

    • Transgenic strategies: Use tissue-specific promoters for targeted expression

    • Viral delivery: Optimize AAV serotypes for Xenopus tissues, similar to approaches used in rodent studies

  • Functional validation:

    • Confirm knockdown/knockout efficiency at both mRNA and protein levels

    • Include rescue experiments with wild-type SYVN1-B to confirm specificity

    • Monitor ER stress markers as functional readouts

    • Assess developmental phenotypes, particularly in neural tissues

  • Potential compensatory mechanisms:

    • Consider redundancy with other E3 ligases in experimental design

    • Monitor expression changes in related genes after SYVN1-B modification

    • Design combination approaches to address redundancy

How can SYVN1-B research in Xenopus inform understanding of human disease mechanisms?

SYVN1-B research in Xenopus can provide valuable insights into human disease mechanisms through comparative biology approaches:

  • Neurodevelopmental disorders: Given the expression of E3 ubiquitin ligases like Rmnd5 in neural tissues and their role in fore- and midbrain development , SYVN1-B studies in Xenopus can elucidate mechanisms underlying human neurodevelopmental disorders where protein quality control is implicated.

  • Metabolic diseases: Mammalian SYVN1 regulates metabolism through degradation of PGC-1β, affecting mitochondrial biogenesis and energy balance . Comparative studies of Xenopus SYVN1-B can reveal evolutionarily conserved metabolic regulatory mechanisms relevant to human obesity and metabolic syndrome.

  • Respiratory diseases: SYVN1 protects against airway remodeling in asthma by suppressing ER stress through SIRT2 degradation . Xenopus models, with their accessible embryonic respiratory structures, can provide unique insights into the developmental origins of respiratory disease susceptibility.

  • ER stress-related pathologies: SYVN1's role in ER stress regulation through the ERAD pathway is implicated in various human diseases. Xenopus studies can help distinguish fundamental from species-specific mechanisms of ER stress management.

By leveraging the experimental advantages of Xenopus (external development, large embryo size, manipulability) while studying conserved disease-relevant pathways, researchers can gain mechanistic insights applicable to human pathology.

What interdisciplinary approaches can enhance SYVN1-B functional characterization?

Enhancing SYVN1-B functional characterization requires integration of diverse methodological approaches across disciplines:

  • Structural biology integration:

    • Cryo-EM to determine SYVN1-B complex architecture

    • X-ray crystallography of isolated domains with substrates

    • NMR studies of dynamic interactions

    • Molecular dynamics simulations to predict conformational changes

  • Systems biology approaches:

    • Network analysis of SYVN1-B interactors across developmental stages

    • Integration of transcriptomic, proteomic, and ubiquitylome data

    • Mathematical modeling of ERAD pathway dynamics with SYVN1-B perturbations

  • Advanced imaging techniques:

    • Super-resolution microscopy to visualize SYVN1-B subcellular localization

    • FRET/BRET systems to monitor real-time interactions with substrates

    • Live imaging of substrate degradation using fluorescent timers

  • Comparative evolutionary biology:

    • Phylogenetic analysis of SYVN1 across species

    • Functional comparison of SYVN1 orthologs from different vertebrates

    • Identification of conserved and divergent regulatory mechanisms

  • Chemical biology strategies:

    • Development of SYVN1-B-specific activity probes

    • Small molecule screening for novel inhibitors or activators

    • Proteolysis-targeting chimeras (PROTACs) approach for controlled SYVN1-B degradation

By combining these interdisciplinary approaches, researchers can develop a comprehensive understanding of SYVN1-B function that spans from molecular mechanisms to physiological significance.

How does SYVN1-B research connect to broader questions in protein quality control?

SYVN1-B research in Xenopus connects to fundamental questions in protein quality control through several conceptual frameworks:

  • Evolution of compartmentalized quality control:

    • SYVN1-B provides insights into how ER-specific quality control mechanisms evolved across vertebrates

    • Comparison with cytosolic, mitochondrial, and nuclear quality control systems reveals organelle-specific adaptations

    • Xenopus as a tetrapod model bridges evolutionary understanding between fish and mammals

  • Integration of stress response pathways:

    • SYVN1-B's role in ER stress management connects to broader cellular stress response networks

    • The relationship between ERAD (via SYVN1-B) and the unfolded protein response reveals coordinated quality control strategies

    • TGF-β pathway interactions suggest cross-talk between developmental signaling and quality control

  • Developmental regulation of protein homeostasis:

    • Stage-specific requirements for protein quality control during development

    • Metamorphosis as a unique developmental window requiring intensive protein quality management

    • Tissue-specific adaptations in quality control mechanisms

  • Substrate selectivity mechanisms:

    • How E3 ligases like SYVN1-B achieve specific recognition among diverse misfolded proteins

    • The balance between specific regulatory degradation and general quality control

    • Comparative substrate repertoires across species revealing core vs. adaptable quality control targets

This research ultimately contributes to understanding how organisms balance protein production, folding, function, and degradation across development and in response to physiological challenges.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.