Recombinant Xenopus laevis Endoplasmic reticulum-Golgi intermediate compartment protein 1 (ergic1)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Xenopus laevis Endoplasmic Reticulum-Golgi Intermediate Compartment Protein 1 (Ergic1)

Recombinant Xenopus laevis Endoplasmic Reticulum-Golgi Intermediate Compartment Protein 1 (Ergic1) is a recombinant protein derived from the African clawed frog, Xenopus laevis. This protein is involved in the early secretory pathway, specifically within the endoplasmic reticulum-Golgi intermediate compartment (ERGIC). The ERGIC plays a crucial role in the trafficking of proteins and lipids between the endoplasmic reticulum and the Golgi apparatus.

Structure and Function of Ergic1

Ergic1 is a full-length protein consisting of 290 amino acids, expressed in Escherichia coli (E. coli) and fused with an N-terminal His tag for easy purification and detection . The protein is available in a lyophilized powder form with a purity of greater than 90% as determined by SDS-PAGE .

CharacteristicsDescription
SpeciesXenopus laevis
SourceE. coli
TagN-terminal His
Protein LengthFull Length (1-290aa)
FormLyophilized powder
Purity>90% (SDS-PAGE)
Storage-20°C/-80°C

Research Findings and Applications

Research on Ergic1 and related proteins has provided insights into the mechanisms of protein trafficking and quality control within the early secretory pathway. These studies are crucial for understanding cellular processes and have implications for biotechnology and biomedical research. For instance, recombinant proteins like Ergic1 can be used in studies to elucidate the molecular mechanisms of protein transport and in the development of therapeutic proteins.

References

- L-Type Lectins in ER-Golgi Intermediate Compartment - PMC
- Eri1: A Conserved Enzyme at the Crossroads of Multiple RNA...
- The effects of whey, pea, and collagen protein supplementation...
- Recombinant Full Length Xenopus Laevis Endoplasmic Reticulum-Golgi Intermediate Compartment Protein 1(Ergic1) Protein, His-Tagged - Creative BioMart
- Compartmentalized Proteomic Profiling Outlines the Crucial Role of...
- ERICH1 Gene - ERIC1 Protein - GeneCards
- The Effects of High-Protein Diets on Kidney Health and Longevity

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag will be determined during production. If you require a specific tag, please inform us; we will prioritize its inclusion.
Synonyms
ergic1; ergic32; Endoplasmic reticulum-Golgi intermediate compartment protein 1; ER-Golgi intermediate compartment 32 kDa protein; ERGIC-32
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-290
Protein Length
full length protein
Species
Xenopus laevis (African clawed frog)
Target Names
Target Protein Sequence
MPFDFRRFDIYRKVPKDLTQPTYTGAIISICCCLFITFLFLSELTGFIANEIVNELYVDD PDKDSGGKIDVTLNVTLPNLPCEVVGLDIQDEMGRHEVGHIDNSMKIPINNAYGCRFEGL FSINKVPGNFHVSTHSAIAQPANPDMRHIIHKLSFGNTLQVDNIHGAFNALGGADKLASK ALESHDYVLKIVPTVYEDLNGKQQFSYQYTVANKAYVAYSHTGRVVPAIWFRYDLSPITV KYTERRQPMYRFITTVCAIIGGTFTVAGILDSFIFTASEAWKKIQLGKMQ
Uniprot No.

Target Background

Function
Plays a potential role in endoplasmic reticulum-Golgi transport.
Database Links

KEGG: xla:431823

UniGene: Xl.30468

Protein Families
ERGIC family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Endoplasmic reticulum-Golgi intermediate compartment membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.