Recombinant Xenopus laevis Endoplasmic reticulum-Golgi intermediate compartment protein 3 (ergic3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
ergic3; Endoplasmic reticulum-Golgi intermediate compartment protein 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-389
Protein Length
full length protein
Species
Xenopus laevis (African clawed frog)
Target Names
ergic3
Target Protein Sequence
METLHRLRQFDAYPKTLEDFRVKTCGGAVVTVISGLIMLILFFSELQYYLTKEVYPELFV DKSRGDKLKINIDVIFPHMPCAYLSIDAMDVAGEQQLDVEHNLFKQRLDLDKKPVTSEAD RHELGKSEEQVVFDPKTLDPNRCESCYGAETDDFSCCNSCDDVREAYRRKGWAFKTPDSI EQCKREGFSQKMQEQKNEGCQVYGFLEVNKVAGNFHFAPGKSFQQSHVHVHAVEIHDLQS FGLDNINMTHEIKHLSFGKDYPGLVNPLDGTSIVAMQSSMMFQYFVKIVPTVYVKVDGEV LRTNQFSVTRHEKMTNGLIGDQGLPGVFVLYELSPMMVKFTEKHRSFTHFLTGVCAIIGG VFTVAGLIDSLIYYSTRAIQKKIELGKAT
Uniprot No.

Target Background

Function

Function: Potentially involved in transport between the endoplasmic reticulum and the Golgi apparatus.

Database Links

KEGG: xla:447415

UniGene: Xl.75436

Protein Families
ERGIC family
Subcellular Location
Endoplasmic reticulum-Golgi intermediate compartment membrane; Multi-pass membrane protein. Golgi apparatus, cis-Golgi network membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is ERGIC3 and what is its functional significance in Xenopus laevis?

ERGIC3, also known as Erv46 and ERp43, is a protein involved in transport between the endoplasmic reticulum and Golgi apparatus. While most research has focused on mammalian ERGIC3, the Xenopus laevis ortholog likely serves similar transport functions with specific adaptations for amphibian cellular physiology. ERGIC3 belongs to a family of proteins that facilitates the bidirectional transport of cargo proteins between the ER and Golgi compartments .

In mammals, ERGIC3 has been characterized as a novel tumor-related gene with abnormal expression in various cancers, including non-small cell lung cancer (NSCLC), liver cancer, and colorectal tumors . The protein's function in Xenopus would likely involve similar transport mechanisms, though potentially adapted to the unique developmental and physiological requirements of amphibians.

Methodologically, researchers investigating Xenopus ERGIC3 should consider complementary approaches:

  • Sequence homology analysis comparing Xenopus ERGIC3 with mammalian orthologs

  • Expression pattern analysis across developmental stages using qRT-PCR

  • Protein localization studies using immunofluorescence with cross-reactive antibodies

  • What experimental protocols are recommended for cloning and expressing recombinant Xenopus laevis ERGIC3?

Successful cloning and expression of recombinant Xenopus proteins requires careful consideration of expression systems and purification strategies. Based on successful approaches with other Xenopus proteins, the following protocol is recommended:

Cloning Procedure:

  • Extract total RNA from Xenopus brain or liver tissue, where ERGIC3 expression is likely higher based on mammalian expression patterns

  • Perform reverse transcription to generate cDNA

  • Amplify the full-length ERGIC3 coding sequence using PCR with primers designed based on the predicted Xenopus laevis ERGIC3 sequence

  • Clone the PCR product into an appropriate expression vector containing a strong promoter and a purification tag

For reference, a similar approach was successful with Xenopus type I iodothyronine deiodinase, resulting in a 1.1 kb clone including a poly-A tail encoding a 252 amino acid protein .

Expression Systems to Consider:

  • Bacterial expression (E. coli) for protein functional studies

  • Mammalian cell transfection for localization and interaction studies

  • Cell-free systems derived from Xenopus egg extracts for native-like post-translational modifications

  • What methods are effective for detecting and quantifying ERGIC3 expression in Xenopus laevis tissues?

Multiple complementary approaches should be employed to comprehensively characterize ERGIC3 expression:

mRNA Detection:

  • Quantitative real-time PCR (qRT-PCR) with ERGIC3-specific primers

  • RNA sequencing of tissues of interest with bioinformatic analysis

Protein Detection:

  • Western blotting using cross-reactive antibodies or custom antibodies raised against Xenopus ERGIC3

  • Immunohistochemistry for tissue localization patterns

Sample Preparation Protocol:

  • Homogenize tissue samples in appropriate buffer (e.g., RIPA buffer with protease inhibitors)

  • Centrifuge at 12,000g for 10 minutes at 4°C

  • Collect supernatant for protein analysis

  • Quantify protein concentration using Bradford or BCA assay

  • Separate proteins by SDS-PAGE and transfer to PVDF membrane

  • Probe with primary antibody (potentially using antibodies generated against mammalian ERGIC3)

  • Visualize with appropriate secondary antibody and detection system

For qRT-PCR, the following parameters have proven effective for other Xenopus genes:

  • RNA extraction using TRIzol reagent

  • cDNA synthesis with oligo(dT) primers

  • SYBR Green-based qPCR with normalization to housekeeping genes (e.g., GAPDH, EF1α)

  • How can researchers develop specific antibodies against Xenopus laevis ERGIC3?

Developing specific antibodies against Xenopus ERGIC3 requires careful antigen design and validation. Based on successful antibody development against human ERGIC3, the following approach is recommended:

Antibody Development Protocol:

  • Design a synthetic peptide from a predicted antigenic region of Xenopus ERGIC3

  • Conjugate the peptide to KLH via an N-terminal cysteine (similar to the approach used for human ERGIC3)

  • Immunize 8-week-old BALB/c mice subcutaneously with the ERGIC3 peptide emulsified in complete Freund's adjuvant

  • Administer booster injections intraperitoneally with the peptide in incomplete Freund's adjuvant

  • Monitor antibody titer using solid-phase ELISA

  • Perform cell fusion when titers reach approximately 1:10,000

  • Screen hybridomas by ELISA and subclone positive clones multiple times

  • Validate antibody specificity through western blotting, immunofluorescence, and immunohistochemistry with proper controls

Antibody Validation:

  • Verify recognition of the native protein by western blot (expected molecular weight for ERGIC3 is approximately 50 kDa)

  • Confirm appropriate subcellular localization (expected to be around the Golgi apparatus and ER)

  • Test cross-reactivity with other Xenopus proteins

  • Include appropriate negative controls (e.g., pre-immune serum, isotype-matched irrelevant antibodies)

Advanced Research Questions

  • How does ERGIC3 expression vary during developmental stages of Xenopus laevis and what methods can detect these patterns?

Investigating developmental expression patterns requires stage-specific analysis:

Recommended Approach:

  • Collect embryos at key developmental stages (blastula, gastrula, neurula, tailbud, tadpole)

  • Extract RNA and protein from whole embryos or dissected tissues

  • Perform stage-specific qRT-PCR and western blot analysis

  • Consider whole-mount in situ hybridization to visualize spatial expression patterns

  • Employ immunohistochemistry on sectioned embryos for protein localization

Data Collection Framework:

Developmental StageMethodSample PreparationAnalysis Approach
Blastula (stage 8-9)qRT-PCR, Western blotWhole embryoCompare to housekeeping genes
Gastrula (stage 10-12)qRT-PCR, In situ hybridizationWhole embryoMap expression domains
Neurula (stage 14-20)qRT-PCR, IHCSectioned embryoTissue-specific localization
Tailbud (stage 24-35)qRT-PCR, Western blot, IHCDissected tissuesQuantitative comparison
Tadpole (stage 45+)qRT-PCR, Western blot, IHCDissected organsRelate to metamorphosis processes

Similar to studies on Xenopus type I iodothyronine deiodinase, researchers should pay particular attention to expression changes during metamorphosis, as this represents a period of significant tissue remodeling where ER-Golgi transport may be especially important .

  • What functional assays can be employed to study ERGIC3's role in protein transport in Xenopus laevis cells?

Investigating ERGIC3's transport function requires specialized assays:

Recommended Functional Assays:

  • Cargo Transport Assay: Track the movement of fluorescently-labeled cargo proteins in ERGIC3-depleted or overexpressing Xenopus cells

  • Brefeldin A Sensitivity Test: Determine if ERGIC3 manipulation alters cellular sensitivity to this Golgi-disrupting agent

  • Protein Secretion Assay: Measure secretion efficiency of model proteins in the presence/absence of functional ERGIC3

  • Co-immunoprecipitation: Identify ERGIC3 binding partners in Xenopus cells

  • FRAP Analysis: Assess protein mobility between ER and Golgi in ERGIC3-manipulated cells

Experimental Design for Cargo Transport Assay:

  • Express a fluorescently-tagged secretory protein in Xenopus cells

  • Manipulate ERGIC3 levels through RNAi knockdown or overexpression

  • Perform live-cell imaging to track cargo movement

  • Quantify transport kinetics and efficiency

This approach can be complemented by using the Xenopus oocyte or egg extract systems, which offer excellent platforms for reconstituting membrane transport processes in a near-native environment .

  • How might ERGIC3 function in immune responses in Xenopus laevis compared to mammals?

Given ERGIC3's identification as an immune function-related gene in mammals, its role in Xenopus immunity merits investigation:

Comparative Research Approach:

  • Analyze ERGIC3 expression in Xenopus immune tissues (spleen, thymus) and isolated immune cells

  • Compare expression patterns during immune challenges (e.g., viral or bacterial exposure)

  • Perform knockdown studies to assess impact on immune cell function

  • Investigate correlation between ERGIC3 expression and levels of immune cell infiltration

Based on mammalian studies, ERGIC3 expression shows correlation with immune cell infiltration, including B cells, CD8+ T cells, CD4+ T cells, macrophages, neutrophils, and myeloid dendritic cells . A similar analysis in Xenopus could be performed using flow cytometry to quantify immune cell populations in relation to ERGIC3 expression levels.

Experimental Design Framework:

  • Stimulate Xenopus immune system with appropriate challenges

  • Collect tissues at defined timepoints

  • Measure ERGIC3 expression alongside markers of immune activation

  • Perform functional assays on isolated immune cells with modified ERGIC3 expression

  • What role might ERGIC3 play in cell cycle regulation and division in Xenopus laevis?

Investigating potential cell cycle roles of ERGIC3 requires specialized approaches:

Research Strategy:

  • Synchronize Xenopus cell cultures and analyze ERGIC3 expression across cell cycle phases

  • Perform knockdown or overexpression studies and assess impact on cell cycle progression

  • Investigate ERGIC3 interaction with known cell cycle regulators

  • Employ Xenopus egg extracts to study ERGIC3 function during mitosis

The Xenopus egg system is particularly valuable for cell cycle studies as demonstrated by research on Aurora B kinase, which affects cytoskeletal dynamics during cell division . Similar approaches could reveal whether ERGIC3 influences membrane dynamics during cell division.

Experimental Considerations:

  • Use synchronized XTC or A6 Xenopus cell lines

  • Employ flow cytometry to assess cell cycle distribution

  • Visualize ERGIC3 localization during different cell cycle stages

  • Consider potential interactions with cell cycle checkpoint proteins

  • How can researchers investigate the potential regulation of Xenopus laevis ERGIC3 by microRNAs?

Based on findings that human ERGIC3 is regulated by miR-203a , similar regulatory mechanisms may exist in Xenopus:

Comprehensive Approach:

  • Bioinformatic Prediction: Use algorithms such as RNAhybrid and miRecords to identify potential miRNA binding sites in Xenopus ERGIC3 mRNA

  • Expression Correlation: Analyze expression patterns of predicted miRNAs and ERGIC3 across tissues and developmental stages

  • Luciferase Reporter Assay: Clone the ERGIC3 3'UTR into a reporter construct to test miRNA binding functionality

  • miRNA Manipulation: Perform gain and loss of function studies with identified miRNAs

Protocol for Luciferase Reporter Assay:

  • Clone the 3'UTR of Xenopus ERGIC3 into a dual-luciferase reporter vector

  • Co-transfect the reporter construct with miRNA mimics or inhibitors

  • Measure luciferase activity 48-72 hours post-transfection

  • Compare with mutated binding site controls

For miRNA expression profiling, the following approach has proven effective:

  • Extract total RNA using a miRNA-preserving method

  • Prepare cDNA using a miScript II RT Kit

  • Perform qRT-PCR with miScript SYBR Green PCR Kit

  • Use U6 as an internal control for normalization

  • What genomic and proteomic approaches are most effective for characterizing the interactome of ERGIC3 in Xenopus laevis?

Understanding ERGIC3's functional network requires integrated approaches:

Multi-omics Strategy:

  • RNA-seq: Compare transcriptomes of ERGIC3-depleted and control Xenopus cells/tissues

  • Quantitative Proteomics: Perform LC-MS/MS analysis of protein changes following ERGIC3 manipulation

  • Protein-Protein Interaction Analysis: Use co-immunoprecipitation coupled with mass spectrometry to identify binding partners

  • Network Analysis: Map identified interactions using bioinformatic tools like STRING and Cytoscape

For RNA-seq analysis, the following parameters have been effective:

  • Filter reads with SOAPnuke v1.5.2

  • Map clean reads to reference genome using HISAT2 v2.0.4

  • Identify differentially expressed genes using DEseq2 (Fold Change ≥ 2.00 and Adjusted P value ≤0.05)

For protein interaction network analysis:

  • Map differentially expressed genes/proteins to the STRING database

  • Visualize the PPI network using Cytoscape 3.8.0

  • Analyze network topology using the Analyze Network plugin

  • Screen modules within the PPI network using MCODE plugin with parameters: degree cutoff = 2, node score cutoff = 0.2, k-score = 2, max.depth = 100

This approach can identify hub genes and functional modules related to ERGIC3, providing insights into its broader functional role in Xenopus cells.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.