Recombinant Xenopus laevis Ephrin-B1 (efnb1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we understand the importance of specific requirements. Please indicate any preferred format when placing your order, and we will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. For precise delivery estimates, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. Should you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend a brief centrifugation of the vial prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference point.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life for the liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is essential. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type will be determined during production. If you have a preferred tag type, please inform us, and we will prioritize its inclusion in the development process.
Synonyms
efnb1; eplg2; lerk2; Ephrin-B1; ELK ligand; ELK-L; EPH-related receptor tyrosine kinase ligand 2; LERK-2; XlERK
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
21-329
Protein Length
full length protein
Species
Xenopus laevis (African clawed frog)
Target Names
efnb1
Target Protein Sequence
LGKNLEPVTWNSQNPRFISGKGLVLYPEIGDRLDIICPKGDSSQPYEYYKLYMVRRDQLEACSTVIDPNVLVTCNQPGKEYRFTIKFQEFSPNYMGLEFRRNQDYYITSTSNSTLQGLENREGGVCQTRSMKIIMKVGQDPNAVPPEQLTTTRPSKEADNTGKIATFGPWNGPVENPGKSDTNLSDKPTAGGGVDGFFNSKIAVFAAIGAGCVIFILIIIFLVVLLIKIRKRHRKHTQQRAAALSLSTLASPKCSGNAGSEPSDIIIPLRTTENNYCPHYEKVSGDYGHPVYIVQEMPPQSPANIYYKV
Uniprot No.

Target Background

Function
Ephrin-B1, a cell surface transmembrane ligand for Eph receptors, plays a crucial role in cell migration, repulsion, and adhesion during the development of neuronal, vascular, and epithelial tissues. It binds promiscuously to Eph receptors on adjacent cells, initiating contact-dependent, bidirectional signaling between neighboring cells. The signaling pathway downstream of the receptor is known as forward signaling, while the signaling pathway downstream of the ephrin ligand is referred to as reverse signaling. Ephrin-B1 is believed to be involved in the development of mesenchymal and nervous tissues.
Gene References Into Functions
  1. Interactions between Smurfs and ephrinB1 regulate the maintenance of tissue boundaries through the control of ephrinB protein levels. PMID: 23475958
  2. Research indicates that the transcriptional co-repressor xTLE1/Groucho interacts with EphrinB1. PMID: 21429299
  3. Ephrin-B1 and Wnt3A signaling contribute to region-specific neuronal plasticity in the developing optic tectum. PMID: 20346764
  4. Tyrosine-298 in ephrin B1 is essential for Grb4 binding. PMID: 14535844
  5. EphrinB1 reverse signaling promotes cellular movements into the eye field and can rescue the FGF receptor-induced repression of retinal fate. PMID: 14723847
  6. Gain- and loss-of-function experiments suggest that Xdsh associates with ephrinB1 and mediates ephrinB1 signaling through downstream members of the PCP pathway during eye field formation. PMID: 16362052
  7. Recruitment of STAT3 to ephrinB1, and its resulting Jak2-dependent activation and transcription of reporter targets, reveals a signaling pathway from ephrinB1 to the nucleus. PMID: 17954917
  8. EphrinB1 associates with the Par polarity complex protein Par-6 and can compete with the small GTPase Cdc42 for association with Par-6. PMID: 18604196
  9. Data demonstrate that phosphorylation of tyrosines 324 and 325 of ephrin B1 disrupts the ephrinB1/Dishevelled interaction, thus modulating retinal progenitor movement that is dependent on the planar cell polarity pathway. PMID: 19005214

Show More

Hide All

Database Links

KEGG: xla:394292

UniGene: Xl.302

Protein Families
Ephrin family
Subcellular Location
Membrane; Single-pass type I membrane protein.
Tissue Specificity
Expressed at low levels in most tissues with highest levels in the kidney, oocytes, ovary and testis.

Q&A

What is Xenopus laevis Ephrin-B1 and what are its key structural features?

Xenopus laevis Ephrin-B1, also known as XLerk, is a transmembrane ligand for Eph receptor tyrosine kinases with approximately 95% homology in its cytoplasmic domain to that of mammalian Ephrin-B1 family members. This high degree of conservation suggests an evolutionarily conserved function for this domain. The protein is characterized by an extracellular domain that interacts with EphB receptors and a cytoplasmic domain capable of reverse signaling. XLerk expression is elevated early during development, particularly during gastrulation, and is also highly expressed in developing neural structures including the hindbrain and retina .

What are the primary functions of Ephrin-B1 in Xenopus laevis development?

Ephrin-B1 in Xenopus laevis plays crucial roles in regulating cell adhesion during the rearrangement of embryonic blastomere cells into developmentally specific germ layers. Research has demonstrated that ectopic overexpression of x-ephrin B1 causes marked dissociation of embryonic cells just prior to gastrulation (in the earlier blastula stage), confirming its ability to modify cell adhesion properties. Additionally, Ephrin-B1 functions both as an activating ligand for Eph receptors and exhibits the ability to signal and regulate cell adhesion through reverse signaling mechanisms .

How does Xenopus Ephrin-B1 interact with other signaling pathways during development?

Xenopus Ephrin-B1 demonstrates significant cross-talk with other signaling pathways, particularly the FGF (Fibroblast Growth Factor) pathway. Studies have shown that FGF treatment can reverse the cell-dissociative effect of x-ephrin B1 in Xenopus embryonic tissue explants, suggesting that the FGF receptor may modulate the function of x-ephrin B1 in regulating cell adhesion. This interaction between FGF receptor activation and Ephrin-B1 signaling represents an important regulatory mechanism during early development . Additionally, Xenopus Dishevelled (Xdsh) forms complexes with both EphB receptors and ephrin-B1, indicating involvement in Eph- and ephrin-mediated signaling pathways .

What mechanisms govern the bidirectional signaling of Ephrin-B1 in Xenopus laevis?

The bidirectional signaling capabilities of Ephrin-B1 in Xenopus involve both forward signaling (through Eph receptors) and reverse signaling (through the cytoplasmic domain of Ephrin-B1). For reverse signaling, the cytoplasmic domain of Ephrin-B1 interacts with various intracellular proteins. One key interaction involves Xenopus Dishevelled (Xdsh), which forms a complex with ephrin-B1. This interaction can occur through two mechanisms: either via the Xdsh-Grb4 complex binding to phosphorylated ephrin-B1, or through direct association between Xdsh and ephrin-B1. The direct interaction between Xdsh and the cytoplasmic region of ephrin-B1 has been confirmed by in vitro binding assays, where in vitro translated Xdsh co-precipitates with GST-tagged ephrin-B1 . These interactions mediate intracellular signaling events that regulate cell adhesion, movement, and developmental patterning.

How does phosphorylation status affect Xenopus Ephrin-B1 function and protein interactions?

Phosphorylation of tyrosine residues in the cytoplasmic domain of Ephrin-B1 significantly influences its interactions with adaptor proteins and downstream signaling pathways. When ephrin-B1's cytoplasmic tyrosine residues are phosphorylated by stimulation of EphB2, it enhances the association with adaptor proteins like Grb4. In experiments, increased expression of Grb4 enhanced the association of Xdd1 (a dominant-negative Xdsh mutant) with tyrosine-phosphorylated ephrin-B1 . This phosphorylation-dependent recruitment mechanism represents a critical regulatory layer in ephrin-B1 reverse signaling. Understanding the specific phosphorylation sites and their effects on protein-protein interactions provides insights into the molecular mechanisms governing ephrin-B1 function in developmental processes.

What are the optimal methods for producing recombinant Xenopus laevis Ephrin-B1 protein?

Based on established protocols for recombinant protein production, the following methodological approach is recommended for producing recombinant Xenopus laevis Ephrin-B1:

Expression System Selection:
While multiple expression systems can be used, mammalian cell lines (particularly HEK-293 cells) offer advantages for producing properly folded and post-translationally modified Ephrin-B1, similar to the successful approach used for human Ephrin-B1 .

Construct Design:

  • Clone the Xenopus laevis Ephrin-B1 cDNA into an appropriate expression vector

  • Include a secretion signal sequence for extracellular domain expression

  • Add an affinity tag (typically His-tag) for purification purposes

  • For full-length protein, ensure the transmembrane domain is preserved

Purification Strategy:

  • Collect conditioned media (for secreted extracellular domain) or lyse cells (for full-length protein)

  • Perform initial purification using nickel affinity chromatography for His-tagged proteins

  • Apply additional purification steps such as size exclusion chromatography

  • Verify protein purity via SDS-PAGE (target >95% purity)

  • Confirm biological activity through binding assays with EphB receptors

This methodology ensures production of high-quality recombinant protein suitable for functional and structural studies.

What assays are most effective for measuring Ephrin-B1 binding activity in Xenopus studies?

Several complementary assays have proven effective for measuring Ephrin-B1 binding activity:

Functional ELISA:
Similar to the approach used for human EFNB1, immobilize purified Xenopus Ephrin-B1 at 0.5 μg/mL and measure binding to EphB receptors across a concentration range (typically 0.1-3.5 ng/mL) . This provides quantitative binding affinity data.

Co-Immunoprecipitation Assays:
For analyzing protein-protein interactions in vivo, co-immunoprecipitation can detect complex formation between Ephrin-B1 and binding partners. This approach successfully demonstrated the association between Xenopus Dishevelled and ephrin-B1 .

In Vitro Binding Assays:
GST pull-down assays using GST-tagged Ephrin-B1 cytoplasmic domain can identify direct protein interactions, as demonstrated in studies showing direct binding between Xdsh and ephrin-B1 .

Cell Aggregation Assays:
Mix cells from animal cap explants from embryos microinjected with EphB receptor or ephrin-B1 (labeled with different colored fluorescence-conjugated dextran) in equal proportions in vitro and allow them to aggregate for several hours. This assay effectively demonstrates cell sorting behaviors mediated by Ephrin-B1/EphB interactions .

How can one design experiments to distinguish between forward and reverse signaling effects of Ephrin-B1?

To distinguish between forward and reverse signaling effects of Ephrin-B1, consider the following experimental approaches:

Domain-Specific Mutations:

  • Create cytoplasmic domain truncations or point mutations in Ephrin-B1 that preserve binding to EphB receptors but eliminate reverse signaling capacity

  • Generate EphB receptor constructs with kinase-dead mutations that can still bind Ephrin-B1 but cannot signal forward

Soluble Fusion Proteins:

  • Use EphB-Fc fusion proteins to specifically activate reverse signaling through Ephrin-B1

  • Use Ephrin-B1-Fc fusion proteins to specifically activate forward signaling through EphB receptors

Cell-Type Specific Manipulations:
In co-culture experiments, selectively express wild-type or mutant constructs in specific cell populations to isolate the contribution of each signaling direction.

Pathway-Specific Inhibitors:
Apply inhibitors targeting specific downstream components of either forward or reverse signaling pathways.

Rescue Experiments:
Test whether expression of constitutively active downstream effectors of either forward or reverse signaling can rescue phenotypes caused by disruption of Ephrin-B1/EphB interactions.

A specific example from the literature demonstrated that FGF receptor activation inhibits x-ephrin B1-induced cell dissociation in Xenopus embryos , providing a model for designing similar mechanistic studies.

How can researchers resolve contradicting data regarding Ephrin-B1 function in different developmental contexts?

When faced with contradicting data regarding Ephrin-B1 function, researchers should implement the following analytical approaches:

Developmental Timing Analysis:
Ephrin-B1 expression changes throughout development, with elevated expression during gastrulation and in developing neural structures . Carefully document and compare the developmental stages examined across studies, as functions may differ temporally.

Tissue-Specific Effects:
Systematically compare results across different tissue types, as Ephrin-B1 may have context-dependent functions. For example, its role in neural tissues may differ from its function during gastrulation.

Dosage-Dependent Effects:
Titrate the amount of Ephrin-B1 expression or inhibition, as different levels may lead to different outcomes. In Xenopus studies, researchers noted that ephrin-B1 mRNA was injected "at a concentration that is not effective for cell dissociation, but high enough to be detectable in injected embryos" .

Pathway Crosstalk Evaluation:
Assess the status of interacting pathways, such as FGF signaling, which can modulate Ephrin-B1 function . Different experimental conditions may alter the balance of these interactions.

Methodological Variance Table:
Create a comparative table documenting key methodological differences between contradicting studies:

Methodological FactorStudy AStudy BPotential Impact on Results
Protein expression systemHEK-293E. coliPost-translational modifications
Developmental stageEarly gastrulaNeurulaStage-specific functions
Experimental readoutCell dissociationAxon guidanceFunction-specific assay sensitivity
Genetic backgroundWild-typeMutant backgroundGenetic modifiers
Concentration usedHigh (specify)Low (specify)Dose-dependent effects

What controls are essential when studying recombinant Xenopus Ephrin-B1 in functional assays?

When designing functional assays with recombinant Xenopus Ephrin-B1, the following controls are essential:

Protein Quality Controls:

  • Purity assessment via SDS-PAGE (aim for >95% purity)

  • Endotoxin testing (target <0.1 EU/μg of protein by LAL method)

  • Protein folding verification through circular dichroism or limited proteolysis

  • Size exclusion chromatography to confirm monomeric state or appropriate oligomerization

Functional Controls:

  • Positive control using validated mammalian Ephrin-B1 with known activity

  • Negative control using non-binding mutant Ephrin-B1 or unrelated protein

  • Dose-response testing to confirm specificity of observed effects

  • Competitive binding assays with unlabeled protein to confirm specificity

Experimental Design Controls:

  • In embryonic studies, include lineage tracer alone as control (as described in the literature)

  • For cell sorting experiments, test cells expressing EphB or ephrin-B1 together with control construct versus cells expressing only EphB or ephrin-B1

  • In rescue experiments, include both wild-type rescue and non-functional construct rescue

Pathway Specificity Controls:

  • Utilize dominant-negative constructs such as Xdd1 (for Dishevelled)

  • Include pathway inhibitors as positive controls for disruption

  • Test cross-reactivity with related pathways (e.g., FGF pathway)

How does Xenopus laevis Ephrin-B1 compare structurally and functionally to its mammalian counterparts?

Xenopus laevis Ephrin-B1 (XLerk) shares significant homology with mammalian Ephrin-B1, particularly in conserved functional domains:

Structural Comparison:

  • Cytoplasmic Domain: 95% homology to mammalian family members, indicating strong evolutionary conservation and functional importance

  • Key Functional Motifs: Conserved PDZ domain-binding motif and tyrosine phosphorylation sites similar to mammalian counterparts

  • Transmembrane Domain: Highly conserved across species

Functional Comparison:

  • Signaling Capabilities: Both Xenopus and mammalian Ephrin-B1 function bidirectionally as both ligands for Eph receptors and as receptors capable of reverse signaling

  • Developmental Roles: Both play crucial roles in tissue boundary formation and cell sorting, though specific developmental contexts differ

  • Protein Interactions: Similar binding partners, including Dishevelled homologs, though the exact binding affinities may vary

What methods are recommended for comparing wild-type versus mutant Ephrin-B1 function in Xenopus?

When comparing wild-type and mutant Ephrin-B1 function in Xenopus, researchers should consider the following methodological approaches:

In Vivo Functional Analysis:

  • Microinjection of wild-type or mutant mRNA into Xenopus embryos at specific blastomeres

  • Phenotypic assessment using morphological criteria, in situ hybridization, or immunostaining

  • Rescue experiments in which mutant phenotypes are tested for rescue by wild-type or modified constructs

Biochemical Comparison:

  • Co-immunoprecipitation assays comparing binding partner interactions between wild-type and mutant proteins

  • Phosphorylation status analysis using phospho-specific antibodies

  • GST pull-down assays to assess direct protein-protein interactions

Cell-Based Assays:

  • Cell aggregation assays comparing the ability of wild-type versus mutant Ephrin-B1 to mediate cell sorting

  • Re-aggregation assays testing whether cells expressing wild-type or mutant Ephrin-B1 intermingle with cells expressing EphB receptors

Quantitative Measurements:
For rigorous comparison, establish quantitative metrics such as:

  • Percentage of embryos showing specific phenotypes

  • Fluorescence intensity measurements in co-localization studies

  • Binding affinities determined through surface plasmon resonance

  • Cell sorting indexes in aggregation assays

What are the common pitfalls in recombinant Ephrin-B1 expression and how can they be addressed?

Researchers commonly encounter several challenges when working with recombinant Ephrin-B1:

Low Expression Yields:

  • Problem: Transmembrane proteins often express poorly in recombinant systems

  • Solution: Optimize codon usage for expression host; use stronger promoters; consider expressing only the extracellular domain; test multiple cell lines (HEK-293 cells have been successful for human Ephrin-B1)

Protein Aggregation:

  • Problem: Improper folding leading to aggregation during purification

  • Solution: Include low concentrations of detergents in purification buffers; optimize purification temperature; consider adding stabilizers; use gentle elution conditions

Inconsistent Activity:

  • Problem: Variable activity between protein batches

  • Solution: Standardize production protocols; implement rigorous quality control testing including binding assays; store protein with stabilizers; avoid freeze-thaw cycles

Post-Translational Modification Issues:

  • Problem: Lack of proper glycosylation or other modifications

  • Solution: Use mammalian expression systems rather than bacterial systems; verify glycosylation status by mass spectrometry or migration pattern on SDS-PAGE

Recommended Quality Control Metrics:

Quality ParameterTarget ValueMethod
Purity>95%SDS-PAGE
Endotoxin level<0.1 EU/μgLAL method
Binding activityLinear range binding to EphBFunctional ELISA
Aggregation statePrimarily monomericSize exclusion chromatography
GlycosylationConsistent patternGlycan analysis or migration pattern

How can researchers address non-specific effects when overexpressing Ephrin-B1 in Xenopus embryos?

When overexpressing Ephrin-B1 in Xenopus embryos, researchers may encounter non-specific effects that can confound interpretation. The following strategies can help address these challenges:

Titration of Expression Levels:

  • Problem: High expression levels may cause toxicity or non-physiological effects

  • Solution: Carefully titrate mRNA concentrations; use published guidelines such as "a concentration that is not effective for cell dissociation, but high enough to be detectable in injected embryos"

Control for Cell Viability:

  • Problem: Expression may affect cell health, confounding functional readouts

  • Solution: Include viability assays; examine cell morphology; use co-injected markers to identify healthy expressing cells

Targeted Expression:

  • Problem: Global expression may mask tissue-specific effects

  • Solution: Use targeted injections to specific blastomeres; employ tissue-specific promoters when possible

Rescue Experiments:

  • Problem: Distinguishing specific from non-specific effects

  • Solution: Perform rescue experiments with wild-type protein or downstream effectors; use structure-function studies with mutant versions

Controls for Pathway Specificity:

  • Problem: Overexpression may cross-activate related pathways

  • Solution: Use pathway-specific inhibitors; test for activation of related pathways; employ dominant-negative constructs like Xdd1 for comparison

Temporal Control:

  • Problem: Continuous expression throughout development versus stage-specific roles

  • Solution: Consider using inducible expression systems; compare effects of expression at different developmental timepoints

What emerging techniques are most promising for studying Ephrin-B1 function in Xenopus development?

Several cutting-edge approaches show particular promise for advancing our understanding of Ephrin-B1 function:

CRISPR/Cas9 Genome Editing:
Precise modification of the endogenous Ephrin-B1 locus in Xenopus allows for studying physiologically relevant expression levels and patterns. This approach enables the creation of point mutations mimicking human disease variants or targeted domain deletions without overexpression artifacts.

Optogenetic Control of Ephrin-B1 Signaling:
Light-inducible dimerization or clustering of Ephrin-B1 provides temporal and spatial control over signaling activation, allowing researchers to dissect the immediate consequences of Ephrin-B1 activation in specific tissues or cells during development.

Live Imaging of Ephrin-B1 Dynamics:
Fusion of fluorescent proteins to Ephrin-B1 enables real-time visualization of protein localization, clustering, and internalization during developmental processes. Combined with advances in light-sheet microscopy, this approach provides unprecedented insights into the dynamics of Ephrin-B1 signaling during tissue morphogenesis.

Single-Cell Transcriptomics:
Analysis of transcriptional changes in individual cells expressing or responding to Ephrin-B1 signals helps identify downstream effectors and cell-type-specific responses, particularly important given the context-dependent nature of Ephrin signaling.

Proximity Labeling Approaches:
BioID or APEX2 fusion proteins allow for identification of the Ephrin-B1 protein interaction network in living Xenopus cells, potentially revealing novel binding partners specific to the Xenopus system.

How might insights from Xenopus Ephrin-B1 research translate to understanding human developmental disorders?

Research on Xenopus Ephrin-B1 provides valuable insights that can be translated to human developmental disorders:

Craniofrontonasal Syndrome (CFNS):
Mutations in the EFNB1 gene result in CFNS in humans, a congenital disorder characterized by a wide range of craniofacial, skeletal, and neurological malformations . Xenopus studies provide a tractable model system to study the cellular and molecular mechanisms underlying these defects.

Translational Research Approaches:

  • Model human CFNS mutations in Xenopus Ephrin-B1 to study functional consequences

  • Test whether modulation of interacting pathways (e.g., FGF signaling) can rescue developmental defects

  • Use Xenopus as a screening platform for potential therapeutic interventions

Comparative Data Table of Ephrin-B1 Function Across Species:

Biological ProcessXenopus laevisHuman/Mammalian
Neural developmentExpressed in hindbrain and retina Critical for neural crest migration and axon guidance
Cell adhesionRegulates adhesion during gastrulation Controls tissue boundary formation
FGF pathway interactionFGF receptor modulates Ephrin-B1 function Similar cross-talk reported in mammalian systems
Dishevelled bindingForms complex with Xdsh Conserved interaction with Dvl homologs

Therapeutic Implications: Understanding the molecular mechanisms through which Ephrin-B1 regulates cell adhesion, migration, and tissue boundary formation in Xenopus provides conceptual frameworks for developing targeted interventions for human developmental disorders associated with EFNB1 mutations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.