Recombinant Xenopus laevis Fatty acid desaturase 2 (fads2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order notes. We will prepare the product according to your specifications.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate this to us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by multiple factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is essential for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize development of the specified tag.
Synonyms
fads2; Fatty acid desaturase 2; Delta(6 fatty acid desaturase; D6D; Delta(6 desaturase; Delta-6 desaturase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-446
Protein Length
full length protein
Species
Xenopus laevis (African clawed frog)
Target Names
Target Protein Sequence
MGMGGQSGEGCSSGDCVKPEAQYSWEEIQKHNLKTDKWLVIERKVYNISQWVKRHPGGMR IIGHYAGEDATDAFHAFHPDKTFVRKFLKPLYIGELAENEPSQDRDKNAQQVEDFRALRK TAEDMRLFKSNPAFFIFYLFHILLIEFLAWCTLHYLGTGWIPAIITVLLLTISQAQAGWL QHDFGHLSVFEKSKWNHLVHKFVIGHLKGASANWWNHRHFQHHAKPNIFSKDPDVNMVNV FVLGGTQPVEFGKKGIKYLPYNHQHLYFFLIGPPLLIPVYFTVQIIKTMIARKDWVDLAW SVSYYVRFFFTFVPFFGVLGSLALLNAVRFFESHWFVWVTQMNHLPMAIEHEKYQDWLNT QLAATCNIEPSFFNDWFSGHLNFQIEHHLFPTMPRHNYWKIAPLVRSLCSKYNVTYEEKC LYHGFRDVLRSLKKSGQLWLDAYLHK
Uniprot No.

Target Background

Function
Fatty acid desaturase 2 (FADS2) is a component of the lipid metabolic pathway that catalyzes the biosynthesis of highly unsaturated fatty acids (HUFA) from precursor essential polyunsaturated fatty acids (PUFA) linoleic acid (LA) (18:2n-6) and alpha-linolenic acid (ALA) (18:3n-3). FADS2 catalyzes the first and rate-limiting step in this pathway, which is the desaturation of LA (18:2n-6) and ALA (18:3n-3) into gamma-linoleic acid (GLA) (18:3n-6) and stearidonic acid (18:4n-3), respectively, along with other desaturation steps. Highly unsaturated fatty acids (HUFA) play crucial roles in various biological functions.
Database Links

KEGG: xla:446688

UniGene: Xl.76092

Protein Families
Fatty acid desaturase type 1 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is FADS2 and why study it in Xenopus laevis?

FADS2 (Fatty Acid Desaturase 2) is a critical enzyme in the metabolism of long-chain polyunsaturated fatty acids (LC-PUFAs), primarily functioning as a Δ6 desaturase in most vertebrate species. The enzyme plays an essential role in introducing double bonds at specific positions in fatty acid carbon chains, a crucial step in LC-PUFA biosynthesis. Xenopus laevis represents an excellent model organism for studying FADS2 due to its evolutionary position as an amphibian, offering insights into the functional conservation of this enzyme across vertebrate evolution. As highlighted in evolutionary studies, FADS2 genes evolved before gnathostome radiation, making comparisons between amphibian and mammalian FADS2 particularly valuable for understanding functional conservation and divergence . Additionally, Xenopus laevis offers practical research advantages, including the production of numerous easily fertilizable eggs, rapid development, and established protocols for genetic manipulation, making it ideal for both developmental and molecular studies of FADS2 function .

How conserved is the FADS2 gene between Xenopus laevis and other vertebrates?

FADS2 exhibits significant evolutionary conservation across vertebrate lineages, with functional homology between amphibian and mammalian versions of the enzyme. Phylogenetic analyses have established that the FADS1 and FADS2 gene lineages diverged early in vertebrate evolution, before the radiation of gnathostomes (jawed vertebrates) . While teleost fish appear to have lost FADS1 genes completely, Xenopus, as an amphibian, likely retains both major FADS gene lineages, positioning it as an important evolutionary reference point. Functional analyses of FADS2 across species reveal conservation of the core Δ6 desaturase activity, though substrate preferences and regulatory mechanisms may vary. The human FADS2 protein consists of 444 amino acids with specific functional domains for desaturase activity, and comparative analyses would likely show significant sequence homology in the catalytic regions between human and Xenopus FADS2 . The evolutionary significance of FADS2 is underscored by the observation that even distantly related vertebrates maintain similar functional roles for this enzyme in fatty acid metabolism, despite some species-specific adaptations .

What advantages does the Xenopus model offer for studying FADS2 function?

Xenopus laevis provides several distinct advantages as a model system for studying FADS2 function and regulation. First, this species produces abundant eggs (approximately one hundred per fertilization) that can be easily fertilized both in vitro and in vivo, enabling researchers to generate numerous embryos quickly throughout the year . Second, Xenopus embryos develop externally and transparently, facilitating real-time observation of developmental processes and the effects of FADS2 activity on organogenesis. Third, the well-characterized developmental stages of Xenopus make it possible to study stage-specific FADS2 expression and function during embryogenesis. Fourth, Xenopus tissues and cell cultures are ideal for long-term live imaging because they are easily maintained without requiring specialized culture conditions, allowing for detailed analysis of FADS2 subcellular localization and activity . Finally, from an ethical perspective, using early-stage Xenopus embryos for research may present fewer concerns compared to mammalian models, while still providing data relevant to vertebrate biology, making it an excellent compromise between research utility and ethical considerations for studying enzyme function in developmental contexts .

What is known about the expression pattern of FADS2 during Xenopus development?

While the search results don't provide specific data on FADS2 expression patterns in Xenopus laevis, general developmental biology principles suggest that FADS2 expression likely follows tissue-specific and stage-dependent patterns related to its role in fatty acid metabolism. During early embryogenesis, FADS2 expression would likely be detectable in tissues with high demand for LC-PUFAs, particularly in the developing nervous system where these fatty acids are crucial for proper development. Xenopus embryonic development is well-characterized with distinct stages that allow precise temporal analysis of gene expression, making it possible to map FADS2 expression throughout development. The Xenopus model is particularly valuable for studying developmental gene expression because of its external development and the ease of collecting embryos at precise developmental timepoints . By analogy with other organisms, FADS2 expression in Xenopus would likely be regulated by both developmental cues and nutritional status, with potential upregulation during periods of rapid cell proliferation and organogenesis when demand for membrane lipids is high.

How does recombinant Xenopus FADS2 compare functionally with the human ortholog?

Recombinant Xenopus FADS2 and human FADS2 likely share core functional mechanisms while exhibiting species-specific differences in substrate preferences and catalytic efficiencies. Human FADS2 primarily functions as a Δ6 desaturase, inserting double bonds at specific positions in fatty acid carbon chains, and the full-length protein consists of 444 amino acids with characteristic histidine-rich regions essential for desaturase activity . While specific enzymatic parameters for Xenopus FADS2 are not detailed in the search results, evolutionary studies indicate that FADS2 genes evolved before gnathostome radiation, suggesting fundamental conservation of function across vertebrate lineages . Notable differences might exist in optimal temperature ranges for enzymatic activity, with Xenopus FADS2 potentially showing higher activity at lower temperatures compared to mammalian orthologs, reflecting the poikilothermic nature of amphibians. Substrate specificity analyses would likely reveal adaptation to the lipid profiles typical of amphibian tissues, which may differ from mammalian lipid compositions based on evolutionary adaptations and dietary patterns. Understanding these comparative aspects is crucial for researchers using Xenopus FADS2 as a model for human fatty acid metabolism, as differences in activity or regulation could affect the interpretation of experimental results and their translational relevance .

What factors influence FADS2 gene expression and enzymatic activity in Xenopus?

Multiple factors likely influence FADS2 gene expression and enzymatic activity in Xenopus laevis, creating a complex regulatory network. Genetic variations in the promoter region represent a primary determinant of expression levels, as demonstrated in comparative studies of FADS2 in other species where multiple SNPs and InDels in the promoter region significantly affected transcriptional activity . Environmental factors, particularly temperature, likely play a crucial role in FADS2 activity in Xenopus, as amphibians are poikilothermic and their enzyme kinetics are temperature-dependent. Developmental stage significantly impacts FADS2 expression patterns, with potential upregulation during specific phases of organogenesis, particularly neural development, where LC-PUFAs are essential structural components. Dietary fatty acid composition may also influence FADS2 expression through feedback mechanisms, with low dietary LC-PUFA potentially upregulating FADS2 to compensate for reduced intake. Additionally, hormonal factors, particularly thyroid hormones involved in metamorphosis, may modulate FADS2 expression as lipid metabolism changes dramatically during the transition from tadpole to adult frog .

How can CRISPR-Cas9 genome editing be optimized for studying FADS2 function in Xenopus?

Optimizing CRISPR-Cas9 genome editing for studying FADS2 function in Xenopus requires careful consideration of several technical aspects to ensure efficient and specific targeting. First, design multiple guide RNAs (gRNAs) targeting conserved functional domains of the FADS2 gene, particularly the histidine-rich regions essential for desaturase activity, while ensuring minimal off-target effects through comprehensive in silico analysis. Second, consider the tetraploid nature of Xenopus laevis, which may necessitate targeting multiple gene copies to achieve complete knockdown of FADS2 function, potentially requiring simultaneous use of several gRNAs targeting different regions of the gene. Third, optimize microinjection parameters for delivering CRISPR-Cas9 components into fertilized Xenopus eggs, including concentration, timing, and injection location, with special consideration for the large size and yolk content of Xenopus eggs. Fourth, establish reliable screening methods for identifying successful editing events, such as T7 endonuclease assays, Sanger sequencing, or high-throughput sequencing approaches. Finally, develop appropriate phenotyping strategies focused on lipid metabolism, including LC-MS analysis of fatty acid profiles and behavioral or developmental assays sensitive to alterations in LC-PUFA composition, taking advantage of the transparent nature of Xenopus embryos to visualize developmental effects .

What are the implications of FADS2 polymorphisms for functional studies in Xenopus?

FADS2 polymorphisms can significantly impact functional studies in Xenopus by introducing variability in enzyme activity and expression levels that must be accounted for in experimental design and data interpretation. Genetic variations in the FADS2 promoter region can substantially alter transcriptional activity, as demonstrated in comparative studies of other species where multiple SNPs and InDels were identified with significant differences in promoter strength . These variations may create differential responses to experimental manipulations, necessitating genotyping of experimental animals to ensure consistent genetic backgrounds. Polymorphisms within the coding region could affect substrate specificity, catalytic efficiency, or protein stability, potentially leading to variable phenotypes even under identical experimental conditions. Linkage disequilibrium among multiple variation sites, as observed in other species' FADS2 genes, suggests that clusters of polymorphisms may co-segregate, creating distinct haplotypes with potentially different functional properties . Researchers should consider establishing standardized Xenopus lines with characterized FADS2 genotypes for reproducible studies, particularly when investigating subtle phenotypic effects or when comparing results across different laboratories.

What are the key considerations for purifying recombinant Xenopus FADS2 while maintaining activity?

Purifying recombinant Xenopus FADS2 while preserving enzymatic activity presents several challenges inherent to membrane-bound desaturases. First, optimal detergent selection is critical for solubilizing FADS2 from membranes without denaturing the protein, with mild non-ionic detergents like n-dodecyl-β-D-maltoside (DDM) or digitonin typically offering a good balance between solubilization efficiency and protein stability. Second, affinity chromatography using tags such as polyhistidine (as used for human FADS2) provides an efficient initial purification step, but tag position must be carefully considered to avoid interfering with enzyme activity or membrane association . Third, maintain a controlled temperature throughout purification (typically 4°C) to minimize protein degradation, particularly important for enzymes from poikilothermic organisms like Xenopus which may be less stable at higher temperatures. Fourth, include appropriate cofactors and stabilizing agents in purification buffers, such as glycerol (typically 10-20%) to enhance protein stability, and consider adding reducing agents like DTT or β-mercaptoethanol to prevent oxidation of critical cysteine residues. Finally, consider reconstitution into artificial membrane systems (liposomes or nanodiscs) for functional studies post-purification, as FADS2 requires a lipid bilayer environment for proper folding and activity; this approach may better preserve the native conformation and catalytic properties compared to detergent-solubilized preparations .

What assays can be used to measure FADS2 enzymatic activity in Xenopus samples?

Several complementary analytical approaches can be employed to measure FADS2 enzymatic activity in Xenopus samples, each offering distinct advantages for different research questions. Gas chromatography-mass spectrometry (GC-MS) represents a gold standard method for detecting and quantifying changes in fatty acid profiles resulting from FADS2 activity, offering high sensitivity and the ability to distinguish between fatty acids differing only in double bond positions. Radiometric assays using 14C-labeled fatty acid substrates provide direct measurement of desaturation activity by tracking the conversion of labeled substrates to desaturated products, offering excellent sensitivity for detecting even low levels of enzymatic activity. Liquid chromatography-mass spectrometry (LC-MS) methods are particularly valuable for analyzing complex lipid samples without derivatization, allowing for detection of intact lipid species containing desaturated fatty acids. For higher throughput screening, fluorescent fatty acid analogs with shifts in emission spectra upon desaturation can be employed, though these may not perfectly recapitulate the behavior of natural substrates. Additionally, oxygen consumption assays can indirectly measure desaturase activity since desaturation reactions require molecular oxygen, providing a real-time continuous measurement option when coupled with appropriate controls to distinguish FADS2-specific oxygen consumption from background oxidative processes.

How can I design primers for cloning and expressing Xenopus laevis FADS2?

Designing effective primers for cloning and expressing Xenopus laevis FADS2 requires consideration of several technical aspects to ensure successful amplification and subsequent protein expression. First, consult genomic databases to obtain the complete FADS2 sequence for Xenopus laevis, being mindful of potential allelic variations due to the tetraploid nature of this species, which may necessitate sequence alignment of multiple gene copies to identify conserved regions for primer binding. Second, design forward primers that include an appropriate restriction enzyme site compatible with your expression vector, a Kozak sequence (GCCACC) immediately upstream of the start codon to enhance translation efficiency, and 18-25 nucleotides of gene-specific sequence with 40-60% GC content for optimal annealing. Third, design reverse primers that include a compatible restriction site, optional tag sequences (such as His-tag) if C-terminal tagging is desired, a stop codon (unless using a vector that provides one), and 18-25 nucleotides of gene-specific sequence that ideally ends with G or C to promote strong 3' binding. Fourth, verify primer specificity using in silico PCR tools to ensure selective amplification of FADS2 rather than related desaturases, particularly important given the presence of multiple FADS gene family members in vertebrate genomes . Finally, consider codon optimization when designing constructs for expression in non-Xenopus systems, as codon usage bias can significantly impact heterologous protein expression levels, especially for membrane proteins like FADS2.

What are the optimal storage conditions for maintaining recombinant Xenopus FADS2 stability?

Maintaining the stability and activity of recombinant Xenopus FADS2 during storage requires careful consideration of several factors to prevent denaturation and loss of enzymatic function. Based on protocols for similar proteins like human FADS2, lyophilization represents an effective long-term storage method, with the lyophilized protein remaining stable at -20°C for extended periods . For liquid formulations, storage buffers should contain glycerol (typically 10-20%) as a cryoprotectant to prevent ice crystal formation during freezing, and consideration should be given to including reducing agents like DTT or β-mercaptoethanol at low concentrations to protect thiol groups from oxidation. The pH of storage buffers should be optimized to match the protein's stability profile, typically in the range of pH 7.0-8.0 for most enzymes, with phosphate or Tris buffers being common choices. Aliquoting the protein into single-use volumes is strongly recommended to avoid repeated freeze-thaw cycles, which can significantly reduce activity through protein denaturation and aggregation. For working stocks, storage at 4°C is preferable to freezing if the protein will be used within one week, as recommended for similar proteins . Additionally, including protease inhibitors in storage buffers can prevent degradation, particularly important for preparations that may contain trace amounts of contaminating proteases from the expression system.

How has the FADS2 gene evolved from amphibians to mammals?

The evolutionary trajectory of FADS2 from amphibians to mammals reveals important adaptations in fatty acid metabolism across vertebrate lineages. Phylogenetic analyses indicate that FADS1 and FADS2 genes evolved before gnathostome radiation, establishing distinct gene lineages with Δ5 and Δ6 desaturase activities, respectively . While teleost fish appear to have lost FADS1 completely, amphibians like Xenopus laevis likely retain both major FADS gene types, positioning them as an important evolutionary reference point. The mammalian lineage has expanded the FADS gene family further, with the identification of FADS3 and a novel FADS4 gene with exclusive occurrence in mammalian genomes, indicating continued evolutionary diversification of these enzymes . Functional adaptations in FADS2 across vertebrate evolution likely reflect changing dietary patterns and environmental conditions, with potential differences in substrate specificity, regulation, and tissue expression patterns. Interestingly, teleost fish have occasionally recruited Δ5 functionality into their FADS2 genes through independent mutations, demonstrating evolutionary plasticity in these enzymes that may also be relevant to understanding amphibian FADS2 function . The conservation of FADS2 across diverse vertebrate lineages underscores its fundamental importance in fatty acid metabolism while allowing for species-specific adaptations in enzyme function and regulation.

How do environmental factors affect FADS2 expression in Xenopus compared to mammals?

Environmental factors likely influence FADS2 expression differently in Xenopus laevis and mammals due to fundamental physiological differences between poikilothermic amphibians and homeothermic mammals. Temperature represents a primary environmental variable with profound effects on Xenopus physiology and enzyme function, directly influencing FADS2 activity and potentially triggering compensatory expression changes at different environmental temperatures. While mammals maintain constant body temperature, Xenopus must adapt its lipid metabolism to varying thermal conditions, potentially through temperature-dependent regulatory mechanisms controlling FADS2 expression. Dietary fatty acid composition affects FADS2 expression through feedback mechanisms in both groups, but Xenopus may show greater plasticity in response to changing dietary availability due to its adaptation to more variable environmental conditions. Seasonal variations likely impact FADS2 expression more significantly in Xenopus than in mammals, potentially correlating with breeding cycles and metabolic adjustments to seasonal temperature fluctuations. Additionally, water-borne environmental contaminants may more directly affect Xenopus FADS2 expression due to the permeable skin of amphibians, which is "susceptible to environmental pollutants due to direct exposure to the environment," making Xenopus particularly valuable for ecotoxicological studies examining environmental impacts on lipid metabolism .

What are the potential applications of Xenopus FADS2 in biotechnology and medical research?

Recombinant Xenopus laevis FADS2 offers diverse applications in biotechnology and medical research, leveraging the unique properties of this amphibian enzyme. In pharmaceutical development, Xenopus FADS2 could serve as a model for screening novel inhibitors or modulators of desaturase activity, potentially leading to therapeutics targeting human fatty acid metabolism disorders. The enzyme could be utilized in metabolic engineering applications to produce specific polyunsaturated fatty acids in heterologous expression systems, possibly with unique catalytic properties compared to mammalian desaturases. Xenopus FADS2 represents an excellent comparative model for evolutionary studies of enzyme function, providing insights into the adaptability of lipid metabolism across vertebrate lineages . In ecotoxicology research, recombinant Xenopus FADS2 could serve as a sensitive biomarker for environmental contaminants that disrupt lipid metabolism, building on Xenopus' established role as "a good indicator of habitat diversity, biological variety and local stressors" . Additionally, structure-function studies of Xenopus FADS2 may reveal novel catalytic mechanisms or substrate interactions not evident in mammalian enzymes, potentially informing protein engineering efforts to create desaturases with enhanced or novel functions for biotechnological applications.

What structural features distinguish Xenopus FADS2 from other vertebrate orthologs?

While the search results don't provide specific structural information about Xenopus FADS2, comparative analysis with other vertebrate FADS2 proteins allows for reasonable predictions about its distinctive features. Like human FADS2 (444 amino acids), Xenopus FADS2 likely contains the characteristic catalytic domains of front-end desaturases, including three highly conserved histidine-rich boxes essential for coordinating metal ions in the active site . As an amphibian protein, Xenopus FADS2 may contain adaptations in its substrate-binding pocket to accommodate the specific fatty acid profiles typical of amphibian tissues, potentially resulting in altered substrate preferences compared to mammalian orthologs. The transmembrane domains anchoring the protein to the endoplasmic reticulum membrane likely show conservation in hydrophobic character while potentially differing in specific amino acid composition to match the membrane properties of amphibian cells. Regulatory regions within the protein, such as phosphorylation sites and interaction motifs, may display species-specific variations reflecting the different signaling networks operating in amphibians versus mammals. Additionally, loop regions connecting the conserved functional domains typically evolve more rapidly than catalytic sites, potentially showing greater divergence between Xenopus and mammalian FADS2 proteins and possibly contributing to differences in enzyme dynamics or interactions with regulatory partners .

How can Xenopus FADS2 be used in toxicological studies?

Xenopus FADS2 offers valuable applications in toxicological research, leveraging the established strengths of Xenopus laevis as a model organism for ecotoxicology studies. The Frog Embryo Teratogenesis Assay—Xenopus (FETAX) test, which "uses early-stage embryos of this species to measure the activity of pollutants during development," could be extended to specifically examine how environmental contaminants affect FADS2 expression and activity, providing insights into mechanisms of developmental toxicity related to lipid metabolism disruption . Recombinant Xenopus FADS2 can be used in direct enzyme inhibition assays to screen environmental compounds for their ability to interfere with desaturase activity, potentially identifying novel mechanisms of toxicity related to disruption of polyunsaturated fatty acid synthesis. The transparent nature of Xenopus embryos enables real-time visualization of developmental effects when FADS2 activity is disrupted, facilitating studies on how toxicants that target this enzyme affect organogenesis, particularly in tissues highly dependent on LC-PUFAs such as the nervous system. Xenopus' permeable skin, which is "susceptible to environmental pollutants due to direct exposure," makes it particularly relevant for studying water-borne contaminants that might affect FADS2 function . Additionally, comparative toxicological studies between Xenopus and mammalian FADS2 could identify species-specific sensitivities to particular toxicants, informing environmental risk assessments and providing evolutionary insights into detoxification mechanisms.

Why might recombinant Xenopus FADS2 show low enzymatic activity in vitro?

Several factors could contribute to low enzymatic activity of recombinant Xenopus FADS2 in vitro, requiring systematic troubleshooting to restore optimal function. Improper protein folding represents a primary concern, particularly for membrane proteins like FADS2 when expressed in heterologous systems that may lack the appropriate chaperones or membrane environment needed for correct conformation. The choice of expression system significantly impacts activity, with prokaryotic systems like E. coli potentially lacking essential post-translational modifications or membrane composition required for amphibian FADS2 function, despite their successful use for human FADS2 expression . Detergent selection during purification is critical, as overly harsh detergents can strip essential lipids from the protein or denature its structure, while insufficient solubilization may result in aggregation; testing multiple detergent types and concentrations may be necessary to optimize activity. The absence of required cofactors could limit activity, as desaturases typically require iron, cytochrome b5, and NADH-cytochrome b5 reductase for the electron transport necessary for catalysis, necessitating supplementation of these components in in vitro assays. Additionally, suboptimal assay conditions, particularly temperature, may significantly impact activity given that Xenopus is poikilothermic, suggesting that activity assays conducted at mammalian physiological temperatures (37°C) may not reflect the optimal temperature range for the amphibian enzyme.

What are common pitfalls in interpreting FADS2 functional data from Xenopus models?

Several potential pitfalls can complicate the interpretation of FADS2 functional data from Xenopus models, requiring careful experimental design and data analysis. The tetraploid nature of Xenopus laevis introduces genetic complexity not present in diploid model organisms, potentially resulting in functional redundancy among FADS2 paralogs that may mask phenotypes in single-gene manipulation studies. Temperature dependency of enzymatic activity presents a significant confounding factor, as experimental temperature directly impacts FADS2 catalytic rates in poikilothermic amphibians, necessitating tight temperature control and reporting in all experiments to ensure reproducibility. Dietary background of experimental animals can significantly influence baseline FADS2 expression and activity through feedback mechanisms, requiring standardized feeding protocols and reporting of dietary fatty acid composition in experimental methods. Developmental stage-specific effects must be carefully considered, as FADS2 expression and functional requirements likely vary dramatically throughout the complex life cycle of Xenopus from embryo to tadpole to adult, potentially leading to stage-dependent phenotypic differences even with identical genetic manipulations . Additionally, species differences in substrate preferences and regulation between Xenopus and mammalian FADS2 may limit direct translational relevance, requiring caution when extrapolating findings to human physiology without complementary studies in mammalian systems.

How can I ensure reproducibility in Xenopus FADS2 expression studies?

Ensuring reproducibility in Xenopus FADS2 expression studies requires rigorous standardization of multiple experimental variables that can influence gene expression and enzyme activity. First, establish consistent animal husbandry protocols, including standardized temperature, lighting cycles, water quality parameters, and dietary regimens, as these environmental factors can significantly impact FADS2 expression levels through various regulatory mechanisms . Second, implement precise developmental staging using established Xenopus developmental series, as FADS2 expression likely varies significantly across developmental stages, making accurate and consistent staging essential for meaningful comparisons between experiments. Third, consider genetic background variations, particularly important in the tetraploid Xenopus laevis where multiple gene copies may exist with different expression patterns, potentially necessitating genotyping of experimental animals or the use of isogenic lines for highly controlled studies. Fourth, standardize tissue collection and processing protocols, including consistent timing of sample collection, rapid tissue preservation methods, and standardized RNA extraction protocols to minimize technical variability in gene expression measurements. Fifth, employ multiple reference genes validated specifically for Xenopus tissues when performing qPCR analysis, as reference gene stability can vary by tissue type and experimental condition. Finally, provide comprehensive methodological reporting in publications, including detailed husbandry conditions, complete primer sequences, qPCR cycling parameters, and computational methods for data normalization, enabling other researchers to precisely replicate experimental conditions critical for reproducible FADS2 expression studies.

What are the emerging techniques for studying FADS2 regulation in Xenopus?

Several cutting-edge techniques are enhancing our ability to study FADS2 regulation in Xenopus, opening new avenues for understanding this crucial enzyme's function. CRISPR-Cas9 genome editing has revolutionized functional genomics in Xenopus, enabling precise modification of FADS2 regulatory regions to interrogate the function of specific promoter elements identified through comparative genomics, similar to approaches used in other species where promoter variants significantly impact transcriptional activity . Single-cell RNA sequencing of Xenopus embryos and tissues provides unprecedented resolution of FADS2 expression patterns, allowing identification of cell-specific regulation and co-expression networks that may reveal novel regulatory mechanisms controlling FADS2 expression during development and in response to environmental stimuli. Chromatin immunoprecipitation sequencing (ChIP-seq) techniques adapted for Xenopus allow genome-wide identification of transcription factor binding sites and histone modifications affecting FADS2 expression, providing comprehensive maps of its regulatory landscape. Reporter assays using promoter constructs with identified variation sites can directly assess the functional impact of specific genetic polymorphisms on FADS2 expression, similar to approaches that have revealed significant differences in transcriptional activity based on promoter variants in other species . Additionally, metabolic flux analysis using stable isotope-labeled fatty acids coupled with mass spectrometry enables dynamic assessment of FADS2 activity in vivo, providing insights into how regulatory changes affect actual enzyme function rather than just expression levels.

What potential exists for FADS2 in comparative evolutionary studies across vertebrates?

FADS2 represents an exceptional candidate for comparative evolutionary studies across vertebrates, offering insights into both functional conservation and adaptive diversification in lipid metabolism. Phylogenetic analyses have already established that FADS1 and FADS2 genes evolved before gnathostome radiation, with Xenopus potentially retaining both genes while teleost fish have lost FADS1 entirely, providing a framework for investigating how gene loss and retention patterns relate to metabolic capabilities across vertebrate lineages . The observation that some teleost species have recruited Δ5 functionality into their FADS2 genes through independent mutations presents fascinating opportunities to study convergent evolution at the molecular level, potentially including comparison with amphibian FADS2 to identify molecular mechanisms enabling functional shifts . Promoter region analysis across species, similar to studies that have identified significant variations in other organisms, could reveal how regulatory evolution has shaped FADS2 expression patterns in response to different environmental and dietary conditions . The discovery of additional FADS family members in specific lineages, such as FADS4 in mammals, offers opportunities to investigate how gene duplication and neofunctionalization contribute to metabolic specialization across vertebrate evolution . Additionally, comparative studies of FADS2 substrate specificity across species from different thermal environments could reveal molecular adaptations in enzyme function related to poikilothermy versus homeothermy, with Xenopus representing an important intermediate evolutionary position between fish and mammals.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.