Recombinant Xenopus laevis Frizzled-10-A (fzd10-a)

Shipped with Ice Packs
In Stock

Description

Introduction to Xenopus laevis Frizzled-10-A

Frizzled-10-A (fzd10-a) belongs to the Frizzled family of seven-transmembrane receptors that serve as primary receptors for Wnt ligands. Xenopus laevis, a model organism extensively used in developmental biology, possesses 10 distinct Frizzled receptors alongside two non-Frizzled receptors, Ror2 and Ryk . These receptors play crucial roles in embryonic development, tissue regeneration, and cellular differentiation through their participation in the Wnt signaling cascade. Frizzled-10-A, specifically, has garnered attention for its involvement in developmental processes and potential role in pathological conditions when its signaling is dysregulated.

The recombinant form of Xenopus laevis Frizzled-10-A protein (referred to as recombinant fzd10-a) is produced through molecular cloning and expression technologies, primarily for research applications. This protein is engineered with specific tags, such as a histidine tag, to facilitate purification and detection in experimental settings . The availability of this recombinant protein enables researchers to investigate its structure-function relationships, binding properties, and role in signal transduction pathways.

Functional Role in Wnt Signaling

Frizzled-10-A, like other members of the Frizzled family, functions primarily as a receptor for Wnt ligands, initiating signal transduction cascades that regulate diverse cellular processes including proliferation, differentiation, and migration.

Signaling Pathway Involvement

Research using recombinant Frizzled-10 has demonstrated its involvement in canonical Wnt signaling. Experiments involving microinjection of FZD10 mRNA into Xenopus early embryos revealed that it can induce partial axis duplication in 40% of embryos . This finding suggests that Frizzled-10 functions as a positive regulator of the Wnt-β-catenin-TCF signaling pathway, potentially leading to activation of specific target genes that control developmental processes .

Furthermore, ventral injection of FZD10 mRNA significantly enhanced the potential of co-injected Xenopus wnt-8 (Xwnt-8) mRNA to induce complete axis duplication, indicating a synergistic interaction between Frizzled-10 and specific Wnt ligands . This functional characteristic highlights the role of Frizzled-10 in modulating developmental processes through coordination with appropriate Wnt signals.

Developmental Expression

While specific expression data for Frizzled-10-A in Xenopus laevis tissues is not extensively detailed in the available search results, studies of Frizzled receptor expression during Xenopus development have revealed tissue-specific and temporally regulated patterns. Different Frizzled receptors, such as Fzd7 and Fzd8, show distinct expression domains in embryonic structures including the pronephric kidney . By comparison, understanding the specific expression patterns of Frizzled-10-A would provide insights into its tissue-specific functions during development.

Laboratory Applications and Handling

Recombinant Xenopus laevis Frizzled-10-A serves as a valuable research tool for investigating Wnt signaling mechanisms, protein-protein interactions, and developmental processes. The availability of purified recombinant protein facilitates various experimental approaches.

Research Applications

Recombinant Xenopus laevis Frizzled-10-A has several potential applications in basic and applied research settings.

Developmental Biology Studies

The recombinant protein can be used to investigate the role of Frizzled-10-A in embryonic development, particularly in the context of axis formation and tissue patterning. The Xenopus axis duplication assay, where positive regulators of the Wnt-β-catenin-TCF signaling pathway induce axis duplication, provides a functional readout for Frizzled activity . By manipulating Frizzled-10-A expression or activity, researchers can elucidate its specific contributions to developmental processes.

Cancer Research

Given the findings that human FZD10 mRNA is up-regulated in primary colon cancer and expressed at relatively high levels in certain cancer cell lines (including cervical cancer and glioblastoma lines) , studying the Xenopus ortholog may provide insights into the role of Frizzled receptors in carcinogenesis. Research suggests that up-regulation of FZD10 might lead to carcinogenesis through activation of the β-catenin-TCF signaling pathway, working synergistically with specific Wnt ligands .

Structure-Function Analysis

The availability of recombinant Frizzled-10-A enables structural studies to understand the molecular basis of its interactions with Wnt ligands and downstream signaling components. These investigations can provide insights into the specificity and selectivity of different Frizzled-Wnt interactions, potentially informing therapeutic strategies targeting Wnt signaling pathways.

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format we currently have in stock. However, if you have specific requirements for the format, please include them in your order notes. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing it for you.
Synonyms
fzd10-a; fz10a; Frizzled-10-A; Fz-10A; Xfz10-A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
27-586
Protein Length
Full Length of Mature Protein
Species
Xenopus laevis (African clawed frog)
Target Names
fzd10-a
Target Protein Sequence
ISSINPDRSGDGRCQAIEIPMCKDIGYNMTRMPNLMGHENQKEAAIQLHEFAPLVEYGCH SHLKFFLCSLYAPMCTEQVSTPIPACRVMCEQARLKCSPIMEQFNFKWPDSLDCSKLPNK NDPNYLCMEAPNNGTDETPRGSSMLPPIFRPQRPSSGHEIYPKDPTSRSSCENSGKFHHV EKSASCAPLCSSSVDVYWSKDDKKFAFIWIAIWSILCFFSSAFTVLTFLVDPLRFKYPER PIIFLSMCYCVYSVGYIIRLFAGADSIACDRDSGQLYVIQEGLESTGCTIVFLILYYFGM ASSLWWVILTLTWFLAAGKKWGHEAIEANSSYFHLAAWAIPAVKTIMILVMRRVAGDELT GVCYVGSMDVNALTGFVLIPLACYLIIGTSFILSGFVALFHIRRVMKTGGENTDKLEKLM VRIGVFSVLYTVPATCVIACYFYERLNMDFWKILATQDKCKMDSQTKTLDCTMTSSIPAV EIFMVKIFMLLVVGITSGMWIWTSKTVQSWQNVFSKRLKKRNRSKPASVITSAGIYKKPQ HPPKVHHGKYESALQSPTCV
Uniprot No.

Target Background

Function
Frizzled-10-A (fzd10-a) is a receptor for Wnt proteins. The majority of frizzled receptors are coupled to the beta-catenin canonical signaling pathway, which leads to the activation of disheveled proteins. This pathway inhibits GSK-3 kinase, resulting in nuclear accumulation of beta-catenin and activation of Wnt target genes. A second signaling pathway involving PKC and calcium fluxes has been observed in some family members, but its relationship to the canonical pathway remains unclear. PKC appears to be essential for Wnt-mediated inactivation of GSK-3 kinase, and both pathways seem to involve interactions with G-proteins. Frizzled-10-A may play a role in the transduction and intercellular transmission of polarity information during tissue morphogenesis and/or in differentiated tissues. It is activated by Wnt8 and may exhibit antagonistic activity during developmental morphogenesis.
Database Links

KEGG: xla:387604

UniGene: Xl.57146

Protein Families
G-protein coupled receptor Fz/Smo family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in liver, lung, brain, testis, stomach, kidney, eye, skeletal muscle and skin.

Q&A

What is Frizzled-10-A and what is its role in Xenopus development?

Frizzled-10-A (fzd10-a), also known as Fz-10A or Xfz10-A, is a member of the Frizzled family of receptors expressed in Xenopus laevis (African clawed frog). It functions as a receptor for Wnt ligands and plays critical roles in embryonic development, particularly in neural development. Frizzled-10-A is specifically expressed in the dorsal neural ectoderm and neural folds in regions where primary sensory neurons develop . The protein mediates canonical Wnt signaling, particularly through interactions with Wnt1 and Wnt8, but notably not with Wnt3a as demonstrated through synergy assays . This selective interaction profile highlights the specificity of Frizzled-10-A's signaling capabilities within the broader Wnt pathway network.

Research has demonstrated that Frizzled-10-A is required for the late stages of sensory neuron differentiation, with both gain-of-function and loss-of-function experiments confirming its essential role in neurogenesis . The developmental significance of Frizzled-10-A extends beyond simple receptor activity, as it appears to function as a key determinant in sensory neural differentiation through its mediation of Wnt1 signaling.

How can recombinant Frizzled-10-A be effectively expressed and purified for experimental use?

Recombinant Frizzled-10-A production typically involves heterologous expression systems optimized for proper protein folding and post-translational modifications. Based on established protocols for Frizzled family proteins, researchers commonly use mammalian expression systems such as HEK293T cells for recombinant Frizzled-10-A production . The process involves several key steps:

  • Vector Construction: The fzd10-a gene sequence is cloned into an appropriate expression vector, often incorporating epitope tags (such as Myc, Flag, or HA) at the C-terminus to facilitate detection and purification . For example, researchers have successfully tagged mouse Tmem79 with Myc or Flag at the C-terminus, and similar approaches can be applied to Frizzled-10-A.

  • Transfection and Expression: The expression construct is transfected into HEK293T cells, which are maintained in DMEM supplemented with 10% FBS, penicillin, and streptomycin . Optimal expression typically requires 24-48 hours post-transfection.

  • Purification Strategy: For purification, researchers can employ affinity chromatography based on the incorporated epitope tags. The recombinant protein is typically stored in a Tris-based buffer containing 50% glycerol for stability .

  • Quality Control: Verification of purified recombinant Frizzled-10-A includes SDS-PAGE, Western blotting, and functional assays to confirm proper folding and activity.

For long-term storage, purified recombinant Frizzled-10-A should be stored at -20°C or -80°C, with working aliquots kept at 4°C for up to one week to avoid repeated freeze-thaw cycles that may compromise protein integrity .

What are the recommended methods for studying Frizzled-10-A localization and trafficking in cells?

Studying Frizzled-10-A localization and trafficking requires a combination of molecular biology and microscopy techniques. The following methodological approach is recommended based on established protocols:

  • Immunofluorescence Microscopy: For visualizing Frizzled-10-A in fixed cells, researchers can follow protocols similar to those used for other membrane proteins. Cells expressing Frizzled-10-A (either endogenous or tagged) are grown on poly-L-lysine-coated glass coverslips, fixed with 4% paraformaldehyde for 10 minutes at room temperature, and permeabilized with 0.2% Triton X-100 in PBS for 5 minutes . After blocking with 10% normal goat serum, cells are incubated with primary antibodies specific to Frizzled-10-A or its epitope tag, followed by fluorescent secondary antibodies (e.g., Alexa Fluor 594 goat anti-rabbit immunoglobulin and Alexa Fluor 488 goat anti-mouse immunoglobulin) .

  • Co-localization Studies: To understand the subcellular localization and trafficking pathways of Frizzled-10-A, co-staining with markers for different cellular compartments is essential. Common markers include PDI (endoplasmic reticulum), TGN46 (trans-Golgi network), and EEA1 (early endosomes) . This approach reveals the distribution of Frizzled-10-A throughout the secretory and endocytic pathways.

  • Live-Cell Imaging: For dynamic studies of Frizzled-10-A trafficking, fusion proteins with fluorescent tags (such as mVenus) can be created . When expressed in Xenopus embryos, these can be visualized using confocal microscopy with photon counting detection to capture the movement and distribution of the proteins at the subapical level of cells .

  • Quantitative Analysis: Intensity plots can be generated to quantify the distribution of fluorescently tagged Frizzled-10-A in the intercellular space, providing insights into how the receptor distributes within tissues .

These methods allow researchers to track both the static localization and dynamic trafficking of Frizzled-10-A through various cellular compartments, providing crucial insights into its regulation and function.

How does Frizzled-10-A contribute to sensory neuron development in Xenopus?

Frizzled-10-A plays a crucial role in sensory neuron development in Xenopus, particularly during the later stages of neurogenesis. Its functions and mechanisms have been elucidated through multiple experimental approaches:

  • Expression Pattern Analysis: Frizzled-10-A is specifically expressed in the dorsal neural ectoderm and neural folds in the regions where primary sensory neurons develop, suggesting a spatially regulated role in neuronal specification . This expression pattern is temporally regulated during development, indicating stage-specific functions.

  • Gain-of-Function Studies: Overexpression of Frizzled-10-A in Xenopus embryos leads to a significant increase in the number of sensory neurons, demonstrating its sufficiency to promote sensory neuron development . This effect occurs through the canonical Wnt signaling pathway, involving β-catenin activation.

  • Loss-of-Function Studies: Morpholino-mediated knockdown of Frizzled-10-A inhibits sensory neuron development at later stages of neurogenesis, confirming its necessity for proper neuronal differentiation . Importantly, this phenotype can be rescued by co-injection of modified Frizzled-10B and β-catenin, providing strong evidence for the specificity of the knockdown and the involvement of canonical Wnt signaling.

  • Signaling Pathway Specificity: Through synergy assays, Frizzled-10-A has been shown to interact with Wnt1 and Wnt8, but not with Wnt3a . This selective interaction with specific Wnt ligands suggests a unique role for Frizzled-10-A in transducing particular Wnt signals during neural development.

These findings collectively indicate that Frizzled-10-A mediates Wnt1 signaling to determine sensory neural differentiation in Xenopus, acting through the canonical β-catenin-dependent pathway to regulate the later stages of neurogenesis . The conservation of this function is supported by experiments in mouse P19 cells, where overexpression of Xenopus Frizzled-10 similarly increased neurogenesis, while siRNA knockdown of mouse Frizzled-10 inhibited this process .

What is the relationship between Frizzled-10-A and kidney development in Xenopus?

While Frizzled-10-A's role in neural development is well-established, its specific contribution to kidney development in Xenopus is less direct but still significant within the broader context of Wnt signaling in pronephros formation:

  • Expression Analysis in Kidney Tissues: Comprehensive studies of Wnt signaling components in Xenopus have shown that out of 10 Frizzled receptors, several (Fzd1, Fzd4, Fzd6, Fzd7, Fzd8) demonstrate distinct expression domains in the pronephric kidney . Frizzled-10-A itself is not among the receptors specifically highlighted for pronephric expression, suggesting its role in kidney development may be limited or indirect.

  • Spatial and Temporal Regulation: Frizzled receptor expression in the pronephros shows remarkable specificity, with distinct patterns not only in spatial domains but also in temporal expression . For example, Fzd8 initially expresses in the pronephros anlage at early stages (stage 20) but later shifts from mesenchyme to epithelium upon tubular differentiation, becoming restricted to the distal tubule and pronephric duct .

  • Wnt Signaling Context: In the Xenopus pronephros, Wnt4, Wnt9a, and Wnt11 are specifically expressed, creating a complex signaling environment where multiple Frizzled receptors, including potentially Frizzled-10-A, may contribute to kidney morphogenesis . The precise interconnections between these components suggest a tightly regulated signaling network.

  • Comparative Receptor Functions: While Frizzled-10-A may not be the primary Frizzled receptor in pronephros development, understanding its function in other contexts helps elucidate the broader principles of Wnt-Frizzled signaling that apply to kidney development. The distinct expression domains of different Frizzled receptors in the pronephros suggest specialized functions that collectively contribute to proper kidney formation .

The complex interplay between multiple Wnt ligands and Frizzled receptors, including Frizzled-10-A, underscores the importance of precisely regulated Wnt signaling in organ development, with the pronephros serving as a valuable model for understanding these processes .

How does Frizzled-10-A interact with different Wnt ligands and what determines its specificity?

Frizzled-10-A exhibits selective interactions with different Wnt ligands, demonstrating a level of specificity that has important implications for its signaling functions. The current understanding of these interactions includes:

  • Differential Wnt Ligand Binding: Synergy assays have demonstrated that Frizzled-10-A interacts with Wnt1 and Wnt8, but not with Wnt3a . This selective interaction profile distinguishes Frizzled-10-A from other Frizzled family members that may have different ligand preferences. The molecular basis for this selectivity likely resides in the structural features of the cysteine-rich domain (CRD) that serves as the primary Wnt-binding region.

  • Canonical Pathway Activation: Frizzled-10-A primarily mediates canonical Wnt signaling, as evidenced by axis duplication assays in early Xenopus embryos . The ability of β-catenin injections to rescue Frizzled-10-A knockdown phenotypes confirms that β-catenin is downstream of Frizzled-10-A, placing it firmly in the canonical Wnt pathway .

  • Ligand-Receptor Specificity Determinants: The specificity of Wnt-Frizzled interactions is determined by several factors:

    • Structural complementarity between the Wnt ligand and the CRD of Frizzled-10-A

    • Expression patterns that create opportunities for specific ligand-receptor pairings

    • Presence of co-receptors or modulatory proteins that may enhance or inhibit certain interactions

    • Post-translational modifications that may alter binding affinities

  • Functional Consequences of Specificity: The selective interaction of Frizzled-10-A with Wnt1 is particularly significant for sensory neuron development, as it appears to be the primary Wnt ligand that signals through Frizzled-10-A in this context . This specificity allows for precise control of developmental processes, where different Wnt-Frizzled pairings can activate distinct downstream responses.

The table below summarizes the known interactions between Frizzled-10-A and different Wnt ligands:

Wnt LigandInteraction with Frizzled-10-ASignaling PathwayDevelopmental Context
Wnt1Strong interactionCanonical (β-catenin-dependent)Sensory neuron development
Wnt8Interaction confirmedCanonical (β-catenin-dependent)Neural development
Wnt3aNo significant interactionN/AN/A

Understanding these specific interactions provides insights into how Frizzled-10-A contributes to the complex regulatory networks that control Xenopus embryonic development.

What role does Frizzled-10-A play in the canonical versus non-canonical Wnt signaling pathways?

Frizzled-10-A's involvement in Wnt signaling pathways demonstrates a preferential engagement with canonical signaling, though its potential roles in non-canonical pathways cannot be entirely excluded:

  • Canonical Pathway Engagement: Multiple lines of evidence confirm Frizzled-10-A's role in canonical Wnt signaling:

    • Axis duplication assays in Xenopus embryos show that Frizzled-10-A activates canonical Wnt signaling

    • Rescue of Frizzled-10-A knockdown phenotypes by β-catenin injections confirms its place in the canonical pathway

    • The promotion of sensory neuron development by Frizzled-10-A occurs through β-catenin-dependent mechanisms

  • Mechanistic Pathway Analysis: In the canonical pathway, Frizzled-10-A binding to Wnt ligands (particularly Wnt1 and Wnt8) leads to disruption of the β-catenin destruction complex, allowing β-catenin to accumulate, translocate to the nucleus, and activate TCF/LEF-dependent transcription of target genes . This mechanism is essential for the proper development of sensory neurons in Xenopus.

  • Non-Canonical Pathway Potential: While the evidence for Frizzled-10-A's role in non-canonical Wnt signaling (such as the planar cell polarity or Wnt/calcium pathways) is less direct, the broader Frizzled family participates in these pathways:

    • Some Frizzled receptors, including other members expressed in Xenopus, interact with core PCP proteins like Celsr1 and Prickle1

    • The expression of these components in developing structures suggests that non-canonical signaling may operate in parallel with canonical pathways

  • Pathway Crosstalk: The potential for crosstalk between canonical and non-canonical pathways adds complexity to understanding Frizzled-10-A's full signaling repertoire. While primarily operating through the canonical pathway, contextual factors may influence whether and how Frizzled-10-A might participate in non-canonical signaling under specific developmental or experimental conditions.

What are the most effective methods for manipulating Frizzled-10-A expression in Xenopus embryos?

Researchers have developed several reliable approaches for both gain-of-function and loss-of-function studies of Frizzled-10-A in Xenopus embryos:

  • Gain-of-Function Approaches:

    • mRNA Microinjection: Injection of synthesized Frizzled-10-A mRNA into specific blastomeres of early Xenopus embryos (typically at the 4-8 cell stage) allows for targeted overexpression . This technique provides temporal control (expression begins immediately after injection) and spatial control (by selecting specific blastomeres).

    • Fluorescent Fusion Proteins: For visualization studies, Frizzled-10-A can be tagged with fluorescent proteins like mVenus by microinjecting mRNAs for these fusion proteins into a single ventral blastomere of four- or eight-cell stage embryos to create source cells . This approach enables live imaging of protein distribution and dynamics.

  • Loss-of-Function Approaches:

    • Morpholino Oligonucleotides: Antisense morpholinos targeting Frizzled-10-A mRNA have been successfully used to inhibit its translation or proper splicing . These morpholinos are typically injected at the early embryonic stages to ensure knockdown during the relevant developmental windows.

    • CRISPR/Cas9 Gene Editing: While not explicitly mentioned in the search results for Frizzled-10-A, CRISPR/Cas9 techniques have been applied to other genes in Xenopus and could be adapted for Frizzled-10-A studies to create genetic knockouts.

  • Rescue Experiments:

    • Co-injection of modified Frizzled-10B (resistant to morpholinos targeting Frizzled-10-A) and β-catenin can rescue the phenotypes caused by Frizzled-10-A knockdown . These experiments confirm specificity and help elucidate downstream pathway components.

  • Technical Considerations:

    • Injection volumes typically range from 5-10 nl per blastomere

    • mRNA concentrations range from 50-500 pg depending on the experiment

    • Morpholino concentrations are typically 10-20 ng per injection

    • Careful staging of embryos according to established Xenopus developmental stages is essential for reproducible results

These methodologies have been successfully applied to demonstrate Frizzled-10-A's role in sensory neuron development and to characterize its interactions with Wnt ligands in vivo .

How can researchers quantitatively assess Frizzled-10-A activity and signaling in experimental systems?

Quantitative assessment of Frizzled-10-A activity and signaling requires a multi-faceted approach that combines molecular, cellular, and functional readouts:

  • Molecular Signaling Assays:

    • TOPFlash Reporter Assays: These luciferase-based reporters contain TCF/LEF binding sites and measure canonical Wnt pathway activation downstream of Frizzled-10-A . Cells are transfected with the reporter construct along with Frizzled-10-A and/or Wnt ligands, and luciferase activity is measured as a quantitative readout of pathway activation.

    • β-catenin Stabilization: Western blotting for β-catenin levels in cytoplasmic and nuclear fractions provides a direct measure of canonical pathway activation by Frizzled-10-A . Quantification of band intensities enables comparison between experimental conditions.

  • Protein-Protein Interaction Assays:

    • Co-immunoprecipitation (Co-IP): For assessing Frizzled-10-A interactions with Wnt ligands or downstream components, epitope-tagged versions (similar to the Myc or Flag-tagged constructs described for Tmem79 ) can be used in Co-IP experiments followed by quantitative Western blotting.

    • Proximity Ligation Assays (PLA): These provide in situ visualization and quantification of protein-protein interactions with single-molecule sensitivity.

  • Cellular Localization and Trafficking:

    • Quantitative Immunofluorescence: Intensity measurements of stained cells provide data on receptor levels and subcellular distribution . Analysis of co-localization with markers of cellular compartments (PDI, TGN46, EEA1) provides quantitative information on receptor trafficking .

    • Intensity Plots for Spatial Distribution: For fluorescently tagged Frizzled-10-A, intensity plots along defined axes in tissue sections or cell cultures provide quantitative data on protein distribution .

  • Functional Readouts in Xenopus:

    • Neuronal Differentiation Markers: Quantification of sensory neuron numbers through in situ hybridization or immunohistochemistry for neuronal markers provides a functional readout of Frizzled-10-A activity . Image analysis software can be used to count positive cells and measure staining intensity.

    • Phenotypic Scoring: Systematic categorization and counting of phenotypes in manipulated embryos (e.g., normal vs. reduced sensory neuron development) provides quantitative data for statistical analysis .

  • Cell Culture Models:

    • Neurogenic Differentiation Assays: Similar to the studies in mouse P19 cells, quantification of neuronal markers after manipulation of Frizzled-10-A levels provides a tractable system for measuring its activity . Flow cytometry or automated image analysis can provide objective quantification of differentiation outcomes.

By combining these approaches, researchers can obtain robust quantitative data on Frizzled-10-A activity across multiple levels, from molecular interactions to developmental outcomes.

How can comparative studies of Frizzled-10-A and Frizzled-10-B inform our understanding of receptor evolution and function?

Xenopus laevis expresses both Frizzled-10-A (fzd10-a) and Frizzled-10-B (fzd10-b), providing an excellent opportunity for comparative studies that can yield insights into receptor evolution and functional specialization:

  • Sequence and Structural Comparisons: Frizzled-10-A and Frizzled-10-B show high sequence similarity but distinct differences. Comparing their amino acid sequences reveals:

    • Frizzled-10-A is referenced under UniProt accession Q9DEB5 , while Frizzled-10-B is under Q9W742

    • Both contain the characteristic cysteine-rich domain (CRD) and seven-transmembrane domains typical of Frizzled receptors

    • Subtle sequence differences may exist particularly in the intracellular domains that could influence downstream signaling specificity

  • Expression Pattern Analysis: Detailed comparison of the spatial and temporal expression patterns of Frizzled-10-A and Frizzled-10-B during Xenopus development can reveal:

    • Overlapping versus distinct expression domains that suggest redundant or specialized functions

    • Temporal dynamics that may indicate sequential roles during development

    • Tissue-specific expression that correlates with distinct developmental processes

  • Functional Redundancy and Specialization: Rescue experiments provide direct evidence of functional relationships:

    • The ability of modified Frizzled-10B to rescue Frizzled-10-A knockdown phenotypes suggests partial functional redundancy

    • The requirement for co-injection with β-catenin for complete rescue indicates potential differences in signaling efficiency or downstream pathway activation

  • Evolutionary Implications: The presence of both Frizzled-10-A and Frizzled-10-B in Xenopus laevis reflects the pseudotetraploid nature of this species:

    • Comparison with single Frizzled-10 genes in diploid species can provide insights into subfunctionalization or neofunctionalization after gene duplication

    • Cross-species comparisons (such as with mouse Frizzled-10) can reveal evolutionarily conserved versus species-specific functions

  • Differential Ligand Interactions: Testing whether Frizzled-10-A and Frizzled-10-B show different affinities for Wnt ligands would reveal:

    • Potential specialization in ligand recognition and binding

    • Differences in downstream pathway activation in response to the same ligand

    • Unique roles in specific developmental contexts

These comparative approaches not only illuminate the specific functions of Frizzled-10-A and Frizzled-10-B in Xenopus but also contribute to our broader understanding of how receptor duplication and divergence drive evolutionary innovation in signaling pathways.

What are the potential applications of Frizzled-10-A research beyond developmental biology?

While Frizzled-10-A has been primarily studied in the context of developmental biology, particularly neural development in Xenopus, its research has broader implications for several fields:

  • Regenerative Medicine and Stem Cell Biology:

    • Understanding how Frizzled-10-A regulates neurogenesis in Xenopus provides insights applicable to mammalian neural stem cell differentiation and potential therapeutic applications

    • The demonstrated ability of Xenopus Frizzled-10 to enhance neurogenesis when overexpressed in mouse P19 cells suggests conserved functions that could be leveraged for regenerative medicine approaches

    • Manipulation of Frizzled-10 signaling might be explored for promoting specific neuronal lineages in stem cell-based therapies for neurodegenerative disorders

  • Cancer Biology:

    • While not directly addressed in the search results for Xenopus Frizzled-10-A, aberrant Wnt signaling is implicated in numerous cancers, and Frizzled receptors represent potential therapeutic targets

    • Insights into the specific mechanisms by which Frizzled-10-A regulates cell proliferation and differentiation during development may inform our understanding of related processes in cancer

    • The specific interactions between Frizzled-10-A and Wnt ligands might suggest novel approaches for targeting particular branches of Wnt signaling in cancer therapy

  • Comparative Signaling Biology:

    • The study of Frizzled-10-A's interactions with other proteins, such as the relationship between TMEM79 and Frizzled receptor degradation through USP8 inhibition , reveals general principles of receptor regulation that may apply across multiple signaling systems

    • Understanding how extracellular dynamics of Wnt ligands interact with Frizzled receptors, including the formation of Wnt/sFRP complexes that modify signaling range , contributes to our general understanding of morphogen gradient formation and interpretation

  • Drug Discovery and Development:

    • Recombinant Frizzled-10-A protein serves as a valuable tool for high-throughput screening of compounds that modulate Wnt signaling

    • Structure-function studies of Frizzled-10-A can guide the design of peptides or small molecules that selectively target specific Frizzled receptors or particular Wnt-Frizzled interactions

    • The detailed molecular understanding of Frizzled-10-A signaling mechanisms helps identify potential points of intervention for therapeutic approaches

  • Systems Biology of Signaling Networks:

    • The complex interactions between multiple Wnt ligands and Frizzled receptors, including Frizzled-10-A, provide a model system for studying principles of signaling specificity, redundancy, and robustness

    • Computational modeling of Wnt-Frizzled interactions, informed by experimental data on Frizzled-10-A, can generate testable predictions about network behavior under various conditions

By extending Frizzled-10-A research beyond its developmental contexts, scientists can leverage this knowledge to address broader questions in biology and medicine, potentially leading to novel therapeutic approaches for conditions involving dysregulated cell proliferation, differentiation, or tissue patterning.

What are the most significant recent advances in Frizzled-10-A research?

Recent advances in Frizzled-10-A research have expanded our understanding of its functions and mechanisms across multiple levels of analysis. Significant breakthroughs include:

  • Mechanistic Insights into Neural Development: The detailed characterization of Frizzled-10-A's role in sensory neuron development has revealed its requirement specifically for the late stages of neurogenesis . This temporal specificity highlights the complex, stage-dependent regulation of neural development by Wnt signaling components. The demonstration that Frizzled-10-A mediates Wnt1 signaling in this context, but not Wnt3a signaling, provides important insights into the specificity of Wnt-Frizzled interactions during development .

  • Cross-Species Conservation of Function: The finding that Xenopus Frizzled-10 can enhance neurogenesis when overexpressed in mouse P19 cells, while siRNA knockdown of mouse Frizzled-10 inhibits this process, demonstrates evolutionary conservation of its neurogenic function . This conservation suggests fundamental roles for Frizzled-10 in vertebrate neuronal differentiation that have been maintained through evolution.

  • Integration with Broader Signaling Networks: Research has begun to place Frizzled-10-A within larger regulatory networks, such as the discovery that TMEM79/MATTRIN defines a pathway for Frizzled regulation and is required for Xenopus embryogenesis . This pathway involves TMEM79 targeting Frizzled receptors for degradation through inhibiting USP8, revealing a novel mechanism for regulating Wnt signaling strength and duration.

  • Advanced Visualization and Quantification: New techniques for visualizing Wnt-Frizzled dynamics in living tissues have provided unprecedented insights into how these signaling components behave in vivo . The application of photon counting detection to track fluorescently tagged proteins in Xenopus embryos has revealed complex patterns of ligand dispersion and receptor localization that were previously inaccessible.

These advances collectively deepen our understanding of Frizzled-10-A's biological functions while also providing new methodological approaches and conceptual frameworks for future research in this field.

What are the most promising directions for future research on Frizzled-10-A?

Future research on Frizzled-10-A holds significant promise in several key areas:

  • Structural Biology and Protein-Protein Interactions: Detailed structural studies of Frizzled-10-A, particularly its cysteine-rich domain in complex with Wnt ligands, would provide crucial insights into the molecular basis of binding specificity. Cryogenic electron microscopy (cryo-EM) or X-ray crystallography of these complexes would advance our understanding of how structural features determine functional specificity in Wnt-Frizzled interactions.

  • Single-Cell Analysis of Signaling Dynamics: Applying single-cell transcriptomics and proteomics to study Frizzled-10-A signaling would reveal cell-to-cell variability in response to Wnt stimulation and uncover potential heterogeneity in neural progenitor populations. This approach could identify novel target genes and regulatory networks downstream of Frizzled-10-A activation.

  • Genome-Wide Approaches to Target Gene Identification: Combining Frizzled-10-A manipulation with techniques like ChIP-seq or ATAC-seq would comprehensively map the genomic loci regulated by Frizzled-10-A-mediated Wnt signaling during neural development. This would provide a more complete picture of the transcriptional programs that drive sensory neuron differentiation.

  • Cross-System Comparative Studies: Expanding comparative studies of Frizzled-10-A function across multiple model organisms would further clarify evolutionarily conserved versus species-specific aspects of its function. While some cross-species validation has been performed (Xenopus to mouse cells) , more systematic comparisons across vertebrates would be valuable.

  • Therapeutic Applications: Exploring the potential of Frizzled-10-A as a target for neurological disorders or regenerative medicine represents an exciting translational direction. The ability to modulate sensory neuron development through Frizzled-10-A manipulation suggests potential applications in conditions involving sensory deficits or neurodegeneration.

  • Integration with Other Signaling Pathways: Investigating how Frizzled-10-A signaling interacts with other developmental pathways (such as Notch, BMP, or Hedgehog signaling) would provide a more complete understanding of the signaling networks that coordinate neural development. This systems-level approach could reveal synergistic or antagonistic relationships between different pathways.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.