Recombinant Xenopus laevis Frizzled-10-B (fzd10-b)

Shipped with Ice Packs
In Stock

Description

Sensory Neuron Differentiation

Fzd10-B mediates canonical Wnt signaling by interacting with Wnt1 and Wnt8 ligands. Key findings include:

  • Overexpression increases sensory neuron count in Xenopus embryos .

  • Morpholino-mediated knockdown reduces sensory neurons, rescued by co-injecting Fzd10B and β-catenin .

  • In mouse P19 cells, Fzd10-B enhances neural differentiation, while siRNA knockdown inhibits it .

Tissue Regeneration

Fzd10-B is expressed in corneal epithelium during lens regeneration in Xenopus larvae, alongside other Frizzled receptors (Fzd1, Fzd2, Fzd3, etc.) and Wnt ligands (Wnt5a, Wnt10a, Wnt11). This suggests a role in regulating Wnt/β-catenin pathways during repair .

Table 2: Key Binding Partners and Pathways

Pathway/FunctionAssociated MoleculesExperimental Evidence
Canonical Wnt signalingWnt1, Wnt8, β-cateninSynergy assays, rescue studies
Neural differentiationRetinoic acid, neurogenesis markersMouse P19 cell assays
Tissue regenerationWnt2b.a, Wnt5a, Wnt11RT-PCR of cornea epithelium

Research Applications

  • Mechanistic Studies: Used to dissect Wnt-Frizzled interactions via pull-down assays .

  • Drug Discovery: Screens for modulators of Wnt signaling in cancer or regenerative medicine .

  • Antibody Production: Immunogen for generating anti-Fzd10-B antibodies .

Limitations and Considerations

  • Species Specificity: Xenopus Fzd10-B shares homology with mammalian Fzd9/Fzd10 but may exhibit functional differences .

  • Activity Validation: Requires functional assays (e.g., TOPFlash reporter) due to lack of post-translational modifications in E. coli-derived protein .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery times, please consult your local distributor.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please notify us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C, and aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
fzd10-b; fz10b; fz9; Frizzled-10-B; Fz-10B; Xfz10-B; Frizzled-9; Fz-9; Xfz9
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
21-580
Protein Length
full length protein
Species
Xenopus laevis (African clawed frog)
Target Names
fzd10-b
Target Protein Sequence
ISSINPDRSGEGRCQAIEIPMCKDIGYNMTRMPNLMGHENQKEAAIQLHEFAPLVEYGCH SHLKFFLCSLYAPMCTEQVSTPIPACRVMCEQARLKCSPIMEQFNFKWPDSLDCSKLPNK NDPNYLCMEAPNNGTDEAPRSSSILPPIFRPQRPNSGHEMYPKDPKGRSSCENSGKFHHV EKSASCAPLCSSSVDVYWSKNDKKFAFIWIAIWSLLCFFSSAFTVLTFLVDPLRFKYPER PIIFLSMCYCVYSVGYIIRLFAGADSIACDRDSGQLYVIQEGLESTGCTIVFLILYYFGM ASSLWWVILTLTWFLAAGKKWGHEAIEANSSYFHLAAWAIPAVKTIMILVMRRVAGDELT GVCYVGSMDVNALTGFVLIPLACYLIIGTSFILSGFVALFHIRRVMKTGGENTDKLEKLM VRIGVFSVLYTVPATCVIACYFYERLNMDFWKILATQDKCKMDSQTKTLDCTMTSSIPAV EIFMVKIFMLLVVGITSGMWIWTSKTVQSWQNVFSKSLKKRNRNKPASVITSAGIYKKPQ QPPKIHHGKYESALRSPTCV
Uniprot No.

Target Background

Function
Frizzled-10-B (fzd10-b) is a receptor for Wnt proteins. Most Frizzled receptors are coupled to the canonical beta-catenin signaling pathway, which triggers the activation of Dishevelled proteins, inhibition of GSK-3 kinase, nuclear accumulation of beta-catenin, and activation of Wnt target genes. A second signaling pathway involving PKC and calcium fluxes has been observed for some family members, but it remains unclear if it represents a distinct pathway or integrates into the canonical pathway. PKC appears to be required for Wnt-mediated inactivation of GSK-3 kinase. Both pathways seem to involve interactions with G-proteins. Frizzled-10-B may play a role in transducing and transmitting polarity information during tissue morphogenesis and/or in differentiated tissues. It is activated by Wnt8 and could exhibit antagonistic activity during morphogenesis in development.
Database Links

KEGG: xla:387605

UniGene: Xl.559

Protein Families
G-protein coupled receptor Fz/Smo family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in liver, lung, brain, testis, heart and ovary.

Q&A

What is Xenopus laevis Frizzled-10-B and how does it differ from Frizzled-10-A?

Xenopus laevis Frizzled-10-B (fzd10-b) is one of two frizzled-10 genes found in X. laevis, reflecting the pseudotetraploidy of this organism. Frizzled-10-B is a 580 amino acid transmembrane receptor protein encoded by a single exon. It differs from Frizzled-10-A (586 amino acids) in length and sequence, though they share 97.0% identity at the amino acid level. Structurally, fzd10-b contains the characteristic N-terminal cysteine-rich domain that serves as the Wnt ligand binding site, seven transmembrane domains, and the C-terminal Ser/Thr-X-Val motif that is important for signaling function .

Interestingly, while Xfz10A shares 85.3% identity with human FZD10 and 62.4% identity with FZD9, Xfz10B is 100% identical to previously reported Xfz9, suggesting potential nomenclature issues in earlier research. The slight differences between Xfz10A and Xfz10B can affect tissue-specific expression patterns, with Xfz10B showing higher expression in heart and ovary tissues compared to Xfz10A's predominance in stomach, kidney, eye, skeletal muscle, and skin .

What is the molecular structure of recombinant Xenopus laevis Frizzled-10-B protein?

Recombinant Xenopus laevis Frizzled-10-B protein, as typically produced for research purposes, comprises amino acids 21-580 of the native sequence. The full-length recombinant protein typically includes:

  • An N-terminal cysteine-rich domain (CRD) that serves as the primary binding site for Wnt ligands

  • Seven transmembrane domains that anchor the protein in the cell membrane

  • A C-terminal Ser/Thr-X-Val motif that participates in downstream signal transduction

  • An affinity tag (commonly His-tag) attached to facilitate purification and detection

When expressed in E. coli systems, the recombinant protein is typically produced without post-translational modifications that would be present in the native eukaryotic protein, which may affect certain functional studies. For structural studies requiring proper folding of the cysteine-rich domain, mammalian or insect cell expression systems may be preferable to bacterial expression systems due to their ability to form proper disulfide bonds.

What expression patterns does Frizzled-10-B show during Xenopus development?

Frizzled-10-B shows distinct spatial and temporal expression patterns during Xenopus development. The mRNA for fzd10-b appears as a 3.4 kb transcript in both adult tissues and embryos. During embryonic development, fzd10-b expression begins at the blastula stage and reaches peak expression during late gastrula stage .

The spatiotemporal expression pattern follows a neural-specific trajectory:

  • At neurula stage: Primarily expressed in the neural fold

  • At tadpole stage: Expression concentrates in the dorsal regions of the midbrain, hindbrain, and spinal cord

  • In adult tissues: Higher expression in heart and ovary compared to other tissues

This neural-centric expression pattern correlates with its functional role in sensory neuron development. The expression in the dorsal neural ectoderm and neural folds specifically occurs in regions where primary sensory neurons develop, providing spatial evidence for its role in neurogenesis .

How does Frizzled-10-B participate in Wnt signaling pathways?

Frizzled-10-B functions as a receptor for specific Wnt ligands, mediating canonical Wnt signaling in Xenopus. Experimental evidence shows that Fz10 interacts specifically with Wnt1 and Wnt8, but not with Wnt3a, as demonstrated through synergy assays . This selective interaction profile determines which Wnt signaling cascades are activated upon ligand binding.

In the canonical pathway, fzd10-b binding to Wnt1 triggers a signaling cascade that ultimately leads to:

  • Inhibition of the β-catenin destruction complex

  • Accumulation of β-catenin in the cytoplasm

  • Translocation of β-catenin to the nucleus

  • Activation of TCF/LEF transcription factors

  • Transcription of target genes involved in sensory neuron differentiation

The functional importance of this pathway is demonstrated by rescue experiments, where inhibition of sensory neuron development caused by fzd10-b knockdown can be reversed by co-injection of modified Fz10B and β-catenin. This confirms that fzd10-b acts through the canonical β-catenin-dependent Wnt pathway to regulate sensory neural development in Xenopus .

What is the specific role of Frizzled-10-B in sensory neuron development?

  • Gain-of-function studies: Overexpression of Fz10 in Xenopus embryos leads to a significant increase in the number of sensory neurons that develop .

  • Loss-of-function studies: Inhibition of Fz10 function using morpholino oligonucleotides specifically inhibits sensory neuron development at later stages of neurogenesis in Xenopus embryos .

  • Rescue experiments: The inhibition of sensory neuron development can be rescued by co-injection of modified Fz10B along with β-catenin, confirming the specificity of the knockdown and the pathway involved .

  • Cross-species validation: In mouse P19 cells induced to undergo neural differentiation by retinoic acid treatment, overexpression of Xenopus Fz10 increases the number of neurons generated, while siRNA knockdown of endogenous mouse Fz10 inhibits neurogenesis .

These findings collectively establish that fzd10-b specifically mediates Wnt1 signaling to determine sensory neural differentiation, affecting the later stages of this process rather than the initial neural induction or early specification events.

How does Frizzled-10-B interact with other proteins in Wnt signaling?

Frizzled-10-B participates in a complex network of protein interactions within the Wnt signaling pathway. Key interactions include:

  • Wnt ligands: Fz10 specifically interacts with Wnt1 and Wnt8 but not Wnt3a, as demonstrated through synergy assays. This selective binding profile determines which developmental processes are activated .

  • β-catenin: The downstream effector of canonical Wnt signaling that translocates to the nucleus following Fz10-mediated signaling. The functional relationship between Fz10 and β-catenin is demonstrated by rescue experiments where co-injection of both factors can restore normal development in Fz10 knockdown models .

  • Dishevelled (Dvl): While not explicitly mentioned in the provided search results, Dishevelled is a critical cytoplasmic phosphoprotein that directly interacts with the intracellular domain of Frizzled receptors to transduce the Wnt signal downstream.

  • Low-density lipoprotein receptor-related proteins (LRP5/6): These co-receptors typically work with Frizzled proteins to initiate canonical Wnt signaling, though their specific interactions with Fz10B are not detailed in the provided sources.

The precise stoichiometry and structural basis of these interactions remain areas for further investigation, particularly regarding potential differences between the interaction profiles of Fz10A and Fz10B.

What are the best expression systems for producing recombinant Xenopus laevis Frizzled-10-B?

The choice of expression system for recombinant Xenopus laevis Frizzled-10-B depends on the specific experimental requirements:

  • E. coli expression system: Commonly used for producing His-tagged full-length Frizzled-10-B (amino acids 21-580) as evidenced by commercial availability . This system offers:

    • High protein yield

    • Cost-effectiveness

    • Simplified purification protocols

    • Limitations in post-translational modifications and proper disulfide bond formation

  • Mammalian cell expression systems (e.g., HEK293, CHO cells):

    • More appropriate for functional studies requiring proper folding

    • Capable of producing proteins with native-like post-translational modifications

    • Better for expressing the transmembrane domains in a functional state

    • Lower yields compared to bacterial systems

  • Insect cell expression systems (e.g., Sf9, High Five):

    • Good compromise between yield and proper eukaryotic processing

    • Particularly suitable for structural studies requiring properly formed disulfide bonds in the cysteine-rich domain

    • Effective for larger scale production of functional protein

For studies focusing on the extracellular cysteine-rich domain (CRD) alone, secreted expression of just this domain in mammalian or insect cells may provide properly folded protein for binding studies. For full transmembrane proteins, mammalian expression systems with appropriate detergent solubilization would be recommended for functional studies.

What methods are effective for studying Frizzled-10-B function in Xenopus embryos?

Several complementary approaches have proven effective for investigating Frizzled-10-B function in Xenopus embryos:

  • Morpholino-mediated knockdown:

    • Injection of antisense morpholino oligonucleotides targeting fzd10-b mRNA

    • Effective for specific inhibition of Fz10 function during embryonic development

    • Loss-of-function studies have demonstrated the requirement of Fz10 for late stages of sensory neuron differentiation

  • mRNA overexpression:

    • Microinjection of in vitro transcribed fzd10-b mRNA into embryos

    • Allows for gain-of-function analysis

    • Has been shown to increase the number of sensory neurons that develop

  • Rescue experiments:

    • Co-injection of modified Fz10B (resistant to morpholino binding) along with pathway components (e.g., β-catenin)

    • Validates specificity of knockdown phenotypes

    • Confirms pathway relationships

  • Synergy assays:

    • Co-expression of Fz10 with different Wnt ligands

    • Determines specific ligand-receptor interactions

    • Has demonstrated that Fz10 interacts with Wnt1 and Wnt8 but not Wnt3a

  • In situ hybridization:

    • Detection of fzd10-b mRNA expression patterns during development

    • Reveals spatiotemporal expression in neural tissues correlating with function

  • RT-PCR analysis:

    • Quantitative assessment of fzd10-b expression levels in different tissues and developmental stages

    • Has shown differential expression patterns between Fz10A and Fz10B

These techniques can be complemented with Xenopus embryo extract preparation for in vitro studies, allowing for biochemical manipulation of signaling pathways in a controlled environment .

How can Xenopus embryo extracts be used to study Frizzled-10-B signaling?

Xenopus laevis embryo extracts provide a powerful cell-free system for studying Frizzled-10-B signaling mechanisms in vitro. This approach offers several advantages:

  • Preparation of developmentally relevant extracts:

    • Embryos can be collected at specific developmental stages (e.g., blastula, gastrula, neurula) when Fz10B is known to be expressed

    • Extracts from different stages can be used to study stage-specific signaling dynamics

  • Biochemical manipulation:

    • Addition of recombinant proteins (e.g., Wnt ligands, Fz10B) to study direct interactions

    • Immunodepletion of specific components to assess pathway dependencies

    • Addition of small molecule inhibitors or activators to probe signaling mechanisms

  • Methodology for extract preparation:

    • Collect and fertilize Xenopus eggs

    • Develop embryos to desired stage

    • Wash embryos in egg lysis buffer (ELB) with protease inhibitors

    • Crush embryos and collect the cytoplasmic layer after centrifugation

  • Applications for Fz10B signaling studies:

    • In vitro reconstitution of Wnt-Fz10B binding events

    • Analysis of Fz10B-dependent phosphorylation cascades

    • Examination of β-catenin stabilization in response to Wnt-Fz10B interaction

    • Comparison of signaling components between early and late developmental stages

This cell-free approach is particularly valuable for dissecting complex signaling events that might be difficult to observe in vivo due to redundancy, developmental constraints, or embryonic lethality.

How do Frizzled-10-A and Frizzled-10-B functionally differ in Xenopus development?

Despite their high sequence similarity (97.0% identity at the amino acid level), Frizzled-10-A and Frizzled-10-B exhibit notable functional differences that may contribute to their distinct roles in Xenopus development:

  • Tissue-specific expression patterns:

    • Xfz10A shows higher expression in stomach, kidney, eye, skeletal muscle, and skin

    • Xfz10B exhibits greater expression in heart and ovary

    • These distinct expression patterns suggest tissue-specific functions despite similar biochemical properties

  • Developmental timing:

    • Both variants are equally expressed in embryos from the blastula stage

    • Both reach peak expression at the late gastrula stage

    • This suggests potential redundancy during early development but specialized roles in adult tissues

  • Structural differences:

    • Xfz10A consists of 586 amino acids versus 580 amino acids for Xfz10B

    • These small sequence differences may affect ligand binding affinities, interaction with co-receptors, or downstream signaling efficiency

    • The specific amino acid differences are primarily concentrated in the non-conserved regions rather than in the highly conserved transmembrane domains or cysteine-rich domain

These subtle differences may translate to distinct functional roles, particularly in adult tissues, that warrant further investigation. Research examining the effects of selectively knocking down either Xfz10A or Xfz10B would provide valuable insights into their potentially non-redundant functions.

What are the comparative differences between Xenopus Frizzled-10-B and mammalian FZD10?

Understanding the evolutionary conservation and divergence between Xenopus Frizzled-10-B and mammalian FZD10 provides insights into fundamental versus species-specific functions:

  • Sequence homology:

    • Xenopus Frizzled-10-A shares 85.3% identity with human FZD10 at the amino acid level

    • Xenopus Frizzled-10-B, while 97.0% identical to Xfz10A, would therefore share approximately 82-83% identity with human FZD10

    • This high level of conservation suggests preservation of core functions across vertebrate evolution

  • Cross-species functional conservation:

    • Xenopus Fz10 overexpression in mouse P19 cells increases neuron generation

    • siRNA knockdown of endogenous mouse Fz10 inhibits neurogenesis

    • These findings demonstrate functional conservation of the neural differentiation role across vertebrate species

  • Domain architecture conservation:

    • Both Xenopus and mammalian Frizzled-10 proteins maintain the characteristic:

      • N-terminal cysteine-rich domain

      • Seven transmembrane domains

      • C-terminal Ser/Thr-X-Val motif

    • This structural conservation underlies the preserved signaling mechanisms

  • Differences in developmental context:

    • The developmental timing and precise neural tissues affected may differ between species

    • The pseudotetraploid nature of Xenopus provides two variants (Fz10A and Fz10B) compared to the single gene in mammals

    • This may allow for more specialized functions in Xenopus compared to mammals

The high degree of conservation suggests that findings from Xenopus studies have translational relevance to understanding mammalian Frizzled function in neural development and potentially in pathological contexts.

What are the challenges in studying Frizzled-10-B protein-protein interactions?

Investigating Frizzled-10-B protein-protein interactions presents several technical and biological challenges:

  • Transmembrane nature of the protein:

    • The seven transmembrane domains make Fz10B difficult to express and purify in a native conformation

    • Solubilization requires detergents that can disrupt native interactions

    • Membrane reconstitution systems may be necessary for authentic interaction studies

  • Dynamic and context-dependent interactions:

    • Fz10B interactions with Wnt ligands and co-receptors are often transient and condition-dependent

    • The formation of higher-order receptor complexes adds complexity to interaction studies

    • Different developmental stages may feature different interaction partners

  • Technical approaches and limitations:

    • Yeast two-hybrid systems are poorly suited for transmembrane proteins

    • Co-immunoprecipitation requires effective antibodies, which may be lacking for Xenopus Fz10B

    • Fluorescence resonance energy transfer (FRET) or bioluminescence resonance energy transfer (BRET) approaches require careful protein tagging that doesn't disrupt function

  • Receptor promiscuity:

    • Frizzled receptors often interact with multiple Wnt ligands with different affinities

    • Identifying the physiologically relevant interactions requires careful consideration of spatiotemporal expression patterns

    • Competition between different Wnt ligands for binding sites further complicates the analysis

  • Solutions and approaches:

    • Xenopus embryo extracts offer a native environment for studying interactions in vitro

    • Split-protein complementation assays can detect interactions in living cells

    • Surface plasmon resonance using purified extracellular domains can quantify binding affinities

    • Proximity labeling approaches (BioID, APEX) can identify the broader interaction network

Addressing these challenges requires integrating multiple complementary techniques and careful validation of results across different experimental systems.

How can findings from Xenopus Frizzled-10-B research be applied to human development and disease?

Research on Xenopus Frizzled-10-B has translational implications for understanding human development and disease mechanisms:

  • Neurodevelopmental disorders:

    • Given fzd10-b's role in sensory neuron development, insights may inform understanding of human sensory processing disorders

    • The high conservation between Xenopus and human Frizzled-10 (>80% amino acid identity) suggests preserved developmental functions

    • Mutations in human FZD10 or its signaling partners may contribute to neurodevelopmental abnormalities

  • Cancer biology:

    • Wnt signaling dysregulation is a hallmark of many cancers

    • The specific interaction between Fz10 and Wnt1 is noteworthy as WNT1 is implicated in several cancer types

    • Understanding the normal developmental functions of Fz10B can provide context for interpreting its potential roles in oncogenesis

  • Tissue regeneration:

    • The role of Fz10B in promoting neurogenesis suggests potential applications in neural regeneration strategies

    • Manipulation of Fz10-mediated signaling might enhance neuronal differentiation in stem cell therapies

    • The cross-species functionality demonstrated in mouse P19 cells supports translational potential

  • Methodological translations:

    • Xenopus embryo extract systems provide valuable in vitro platforms for screening compounds that modulate Frizzled signaling

    • Morpholino approaches in Xenopus can validate targets before more costly mammalian studies

    • The accessibility of Xenopus embryos allows for efficient testing of signaling hypotheses

  • Challenges in translation:

    • Species-specific differences in receptor distribution and tissue architecture

    • Complexity added by gene duplication events (Fz10A and Fz10B in Xenopus vs. single FZD10 in humans)

    • Different cellular contexts may result in divergent signaling outcomes despite receptor conservation

Despite these challenges, the fundamental conservation of Frizzled-10 structure and function across vertebrates makes Xenopus research a valuable translational resource.

What is the relationship between Frizzled-10-B function and neural pathologies?

The critical role of Frizzled-10-B in sensory neuron development suggests potential links to various neural pathologies:

  • Sensory processing disorders:

    • Fz10B's specific role in sensory neuron differentiation suggests its dysfunction could contribute to abnormal sensory development

    • Alterations in the number or connectivity of sensory neurons due to Fz10B dysfunction might affect sensory integration

  • Neurodevelopmental timing abnormalities:

    • Fz10B specifically affects later stages of neurogenesis rather than initial neural induction

    • This temporal specificity suggests potential involvement in disorders characterized by disrupted developmental timing

  • Potential connections to specific conditions:

    • Although not directly established in the provided research, the sensory neuron development role suggests potential relevance to:

      • Autism spectrum disorders (often featuring sensory processing abnormalities)

      • Peripheral neuropathies affecting sensory function

      • Neurodegenerative conditions affecting sensory pathways

  • Wnt pathway involvement in neurological disorders:

    • The Wnt/β-catenin pathway that Fz10B participates in has been implicated in:

      • Alzheimer's disease (through β-catenin interactions with presenilin)

      • Schizophrenia (through disrupted neurodevelopment)

      • Mood disorders (through effects on adult neurogenesis)

  • Research approaches to establish pathological connections:

    • Human genetic studies examining FZD10 variations in patients with sensory processing disorders

    • Functional validation using Xenopus models to test effects of disease-associated mutations

    • In vitro differentiation studies comparing normal and pathological sensory neuron development

While direct evidence linking Fz10B dysfunction to specific human neural pathologies is limited in the provided research, the fundamental role in sensory neuron development provides a strong rationale for investigating such connections.

What are emerging research questions regarding Frizzled-10-B function?

Despite significant progress in understanding Xenopus laevis Frizzled-10-B, several important questions remain unanswered:

  • Molecular mechanisms of ligand specificity:

    • How does Fz10B structurally distinguish between Wnt1/Wnt8 and other Wnt ligands like Wnt3a?

    • What is the structural basis for the interaction specificities?

    • How do co-receptors modulate these interactions?

  • Downstream transcriptional targets:

    • What are the specific genes activated by Fz10B-mediated Wnt signaling during sensory neuron differentiation?

    • How do these targets differ from those activated by other Frizzled receptors?

    • What is the temporal sequence of transcriptional events following Fz10B activation?

  • Functional divergence between Fz10A and Fz10B:

    • What are the functional consequences of the 3% sequence difference between these proteins?

    • Do they activate distinct downstream pathways despite their high similarity?

    • How has evolution maintained both genes following the genome duplication event in Xenopus?

  • Non-canonical signaling potential:

    • Does Fz10B exclusively signal through the canonical β-catenin pathway, or can it activate non-canonical Wnt pathways under certain conditions?

    • What determines pathway selection if multiple signaling options exist?

  • Regulatory mechanisms:

    • How is Fz10B expression itself regulated during development?

    • What epigenetic mechanisms control its tissue-specific expression patterns?

    • Are there post-translational modifications that regulate Fz10B function?

Addressing these questions will require integrating advanced molecular, cellular, and developmental approaches, potentially including CRISPR/Cas9-mediated genome editing in Xenopus, single-cell transcriptomics, and structural biology techniques.

What methodological advances are needed for better understanding of Frizzled-10-B?

Advancing our understanding of Frizzled-10-B requires several methodological improvements:

  • Improved protein production systems:

    • Development of expression systems that yield properly folded full-length Fz10B in sufficient quantities for structural studies

    • Optimization of detergent solubilization or nanodiscs for maintaining native conformation of the transmembrane domains

    • Production of domain-specific antibodies for improved detection and purification

  • Structural biology approaches:

    • Cryo-electron microscopy of Fz10B in complex with its Wnt ligands and co-receptors

    • X-ray crystallography of the extracellular cysteine-rich domain bound to different Wnt proteins

    • NMR studies of the intracellular domains to understand interaction with downstream effectors

  • Advanced in vivo techniques:

    • Development of conditional/inducible knockdown systems in Xenopus

    • CRISPR/Cas9-mediated genome editing to introduce specific mutations or tags

    • Live imaging techniques to visualize Fz10B trafficking and signaling in real-time during development

  • Systems biology integration:

    • Single-cell transcriptomics to resolve cell-type specific responses to Fz10B signaling

    • Proteomics approaches to identify the complete Fz10B interactome

    • Mathematical modeling of how Fz10B signaling integrates with other developmental pathways

  • Translational tools:

    • Development of specific modulators (agonists/antagonists) of Fz10B for potential therapeutic applications

    • Humanized models to better translate findings from Xenopus to human biology

    • Improved disease models to test Fz10B involvement in neurological conditions

These methodological advances would collectively enhance our ability to dissect the molecular mechanisms, developmental functions, and potential therapeutic applications of Frizzled-10-B signaling.

What is the recommended protocol for generating functional recombinant Frizzled-10-B protein?

The following protocol outlines the production of functional recombinant Xenopus laevis Frizzled-10-B protein:

Expression System Selection:

  • For structural studies or binding assays of the extracellular domain: insect cell expression (Sf9 or High Five cells)

  • For full-length protein studies: mammalian expression system (HEK293 or CHO cells)

  • For higher yields with potentially compromised function: E. coli expression system

Expression Construct Design:

  • Clone Xenopus laevis fzd10-b cDNA (amino acids 21-580) into an appropriate expression vector

  • Include a cleavable affinity tag (His-tag or Fc-fusion) preferably at the C-terminus

  • Consider codon optimization for the selected expression system

  • For membrane proteins, include a signal peptide for proper membrane targeting

Expression and Purification Protocol:

  • Transform/transfect expression construct into selected host system

  • For E. coli:

    • Induce expression at lower temperatures (16-18°C) to improve folding

    • Solubilize inclusion bodies if necessary using appropriate detergents

    • Purify using immobilized metal affinity chromatography (IMAC)

    • Perform refolding if expressed in inclusion bodies

  • For insect/mammalian cells:

    • Harvest cells 48-72 hours post-infection/transfection

    • Solubilize membranes using mild detergents (DDM, LMNG, or GDN)

    • Purify using affinity chromatography followed by size exclusion chromatography

    • Consider adding cholesterol or specific lipids to stabilize the protein

Quality Control:

  • Verify protein integrity by SDS-PAGE and Western blotting

  • Assess protein folding by circular dichroism spectroscopy

  • Confirm functionality through ligand binding assays using purified Wnt proteins

  • For full-length proteins, consider reconstitution into proteoliposomes or nanodiscs

This protocol maximizes the likelihood of producing functionally active Frizzled-10-B suitable for various research applications while acknowledging the inherent challenges of membrane protein expression and purification.

What is the standard methodology for studying Frizzled-10-B expression during Xenopus development?

The following standardized methodology can be employed to study Frizzled-10-B expression during Xenopus development:

1. Temporal Expression Analysis by RT-PCR:

  • Collect embryos at different developmental stages (from blastula to tadpole)

  • Extract total RNA using TRIzol or equivalent reagent

  • Synthesize cDNA using oligo(dT) primers and reverse transcriptase

  • Design primers specific to fzd10-b (avoiding cross-amplification of fzd10-a)

  • Perform semi-quantitative or quantitative RT-PCR

  • Normalize expression to housekeeping genes (e.g., ornithine decarboxylase)

2. Spatial Expression Analysis by In Situ Hybridization:

  • Design RNA probes specific to fzd10-b

  • Fix embryos at different developmental stages in 4% paraformaldehyde

  • Hybridize with digoxigenin-labeled antisense RNA probes

  • Detect using anti-digoxigenin antibodies conjugated to alkaline phosphatase

  • Develop with chromogenic substrates (NBT/BCIP)

  • Section embryos if needed for higher resolution analysis

3. Protein Expression Analysis:

  • Generate antibodies specific to Fz10B (challenging due to high similarity with Fz10A)

  • Prepare embryo extracts from different developmental stages

  • Perform Western blotting with anti-Fz10B antibodies

  • Use immunohistochemistry on sectioned embryos to localize protein expression

4. Functional Analysis of Expression Domains:

  • Design targeted morpholino oligonucleotides specific to fzd10-b

  • Inject morpholinos into specific blastomeres that contribute to fzd10-b expression domains

  • Analyze phenotypic effects on sensory neuron development

  • Perform rescue experiments with co-injection of morpholino-resistant fzd10-b mRNA

5. Transgenic Reporter Approaches:

  • Create reporter constructs with fzd10-b promoter driving fluorescent protein expression

  • Generate transgenic Xenopus embryos

  • Image live embryos to track expression patterns throughout development

This comprehensive approach provides multiple lines of evidence regarding the spatiotemporal expression pattern of Frizzled-10-B during Xenopus development, correlating expression with its functional role in sensory neuron differentiation.

How does Frizzled-10-B compare to other Frizzled family members in Xenopus laevis?

Xenopus laevis expresses multiple Frizzled family members, each with distinct characteristics that distinguish them from Frizzled-10-B:

FeatureFrizzled-10-BOther Frizzled Family Members
Number in XenopusTwo variants (Fz10A, Fz10B) due to pseudotetraploidy Five members expressed in early nervous system
Amino Acid Length580 amino acids Varies by family member (typically 500-700 AA)
Expression PatternNeural fold at neurula stage; dorsal midbrain, hindbrain, spinal cord at tadpole stage; heart and ovary in adults Varies: Fz3 (brain, eye, neural tube); Fz4 (widespread); Fz7 (dorsal mesoderm, neural tissue)
Wnt Ligand SpecificityInteracts with Wnt1 and Wnt8, but not Wnt3a Different specificities: Fz3 (Wnt1, Wnt3a); Fz4 (Wnt2, Wnt5a); Fz7 (Wnt8, Wnt11)
Signaling PathwayCanonical Wnt/β-catenin pathway Varies: Some primarily canonical (Fz1, Fz8), others non-canonical (Fz7)
Developmental RoleLate stages of sensory neuron differentiation Diverse roles: Fz3 (neural patterning); Fz4 (vascular development); Fz7 (gastrulation movements)
Sequence Conservation97.0% identity between Fz10A and Fz10B; 85.3% identity between Fz10A and human FZD10 Variable conservation between species and family members

This comparative analysis highlights the specialized role of Frizzled-10-B in sensory neuron development compared to the broader functions of other family members in various aspects of Xenopus development. The specific Wnt ligand interaction profile and expression pattern of Frizzled-10-B contribute to its unique developmental function despite the structural similarities shared across the Frizzled family.

What experimental systems beyond Xenopus are useful for studying Frizzled-10-B function?

Multiple experimental systems complement Xenopus models for studying Frizzled-10-B function, each offering distinct advantages:

  • Mouse P19 Cell Line:

    • Established neuronal differentiation model induced by retinoic acid

    • Shown to respond to Xenopus Fz10 overexpression with increased neurogenesis

    • Allows for siRNA knockdown of endogenous Fz10 to inhibit neurogenesis

    • Provides a mammalian context to validate findings from Xenopus

  • Mouse Models:

    • Knockout/knockin approaches for Fzd10

    • More direct relevance to human biology than Xenopus

    • Allows for tissue-specific and inducible manipulation of gene expression

    • Permits long-term developmental and behavioral studies

  • Human iPSC-Derived Neural Models:

    • Differentiation into sensory neurons to study FZD10 function

    • Patient-derived lines for studying disease-relevant mutations

    • Allows for CRISPR/Cas9 genome editing to modify FZD10

    • Directly relevant to human development and disease

  • Zebrafish Models:

    • Transparent embryos allowing for live imaging of neural development

    • Ease of genetic manipulation via morpholinos or CRISPR/Cas9

    • Rapid development and high fecundity

    • Complementary vertebrate model with single fzd10 gene (vs. duplicated genes in Xenopus)

  • Drosophila Models:

    • Simplified Frizzled family with fewer members

    • Powerful genetic tools for pathway dissection

    • Rapid generation time and well-characterized neural development

    • Allows study of evolutionarily conserved Frizzled functions

  • In Vitro Reconstitution Systems:

    • Purified proteins in artificial membranes or nanodiscs

    • Allows for detailed biochemical and biophysical studies

    • Suitable for structural studies by cryo-EM or X-ray crystallography

    • Enables precise manipulation of signaling components

Each system offers complementary strengths, and integrating findings across multiple models provides the most comprehensive understanding of Frizzled-10-B function. The demonstration that Xenopus Fz10 functions similarly in mouse P19 cells suggests significant conservation of fundamental mechanisms across vertebrate species .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.