Recombinant Xenopus laevis Frizzled-3 (fzd3)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Xenopus laevis Frizzled-3 (FZD3)

Recombinant Xenopus laevis Frizzled-3 (FZD3) is a genetically engineered form of the FZD3 receptor, a critical component of the Wnt signaling pathway. This protein is synthesized in heterologous expression systems to enable biochemical and functional studies of its role in embryonic development, neurogenesis, and cell polarity regulation . FZD3 belongs to the Frizzled family of seven-transmembrane G-protein-coupled receptors (GPCRs) that bind Wnt ligands to activate both canonical (β-catenin-dependent) and non-canonical (planar cell polarity, PCP) signaling pathways .

Functional Role in Wnt Signaling Pathways

FZD3 is a key regulator of non-canonical Wnt/PCP signaling in Xenopus laevis, influencing:

  • Axon Guidance: Directs growth and pathfinding of inner ear afferents and forebrain neurons .

  • Embryonic Eye Development: Activates alcam expression via JNK1 and Pax2 transcription factors .

  • Neural Crest Cell Migration: Governs polarity and directional movement during embryogenesis .

In Xenopus, FZD3 interacts with ligands like Wnt-5A and Wnt-11 to coordinate tissue patterning . Unlike canonical Wnt/β-catenin signaling, FZD3 primarily activates PCP pathways involving Rho GTPases and JNK kinases .

Applications in Developmental Biology Research

Recombinant FZD3 is utilized to:

  • Study Receptor-Ligand Interactions: Binding assays with Wnt proteins (e.g., WNT-3A, WNT-5A) to map affinity and specificity .

  • Investigate Neural Circuit Assembly: Conditional knockout models reveal FZD3’s cell-autonomous role in axon guidance .

  • Model Human Diseases: Links to schizophrenia and neurodevelopmental disorders via disrupted Wnt signaling .

Key Studies Using Recombinant FZD3

StudyFindings
Inner Ear Afferent Pathfinding (Duncan et al., 2019) Conditional deletion of Fzd3 in afferents disrupts cochlear and vestibular axon targeting in the hindbrain.
WNT-FZD Binding Kinetics (Nile et al., 2015) WNT-3A binds FZD3 CRD with higher affinity (K<sub>D</sub> ~8 nM) than WNT-5A (K<sub>D</sub> ~120 nM).
Eye Development (Löhr et al., 2017) FZD3 regulates alcam promoter activity via JNK1/Pax2 in Xenopus optic vesicles.

Functional Assays

  • TOPFlash Reporter Assays: Show TMEM79-mediated FZD3 degradation reduces Wnt/β-catenin signaling .

  • Co-Immunoprecipitation: Confirms interactions with SDCBP (syntenin-1) and USP8 deubiquitinase .

Product Specs

Form
Lyophilized powder
Note: While we will preferentially ship the format currently in stock, we are happy to accommodate specific format requirements. Please indicate your preference in the order notes, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery information.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
fzd3; fz3; Frizzled-3; Fz-3; Xfz3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
17-664
Protein Length
Full Length of Mature Protein
Species
Xenopus laevis (African clawed frog)
Target Names
Target Protein Sequence
QKSMGHSLFACEPITLRMCQDLPYNSTFMPNLLNHYDQQTAALAMEPFHPMVNLECSRDL RPFLCALYTPVCMEYGRMTLPCRKLCQRAYNECFKLMEMFGVPWPEEMECSRFPDCDEPY PRIVDISLSGEPSEETPLAVQRDYGFWCPRELKIDPDLRSSFLGVRDCSPPCPHMYFRRE ELSFARYFIGVISIVCLSATLFTFLTFLIDVTRFRYPERPIIFYAVCYMMVSLIFFIGFL LEDKVACNGANPSQYKASTVTQGSHNKACTMLFMVLYFFTMAGSVWWVILTITWFLAAVP KWGSEAIEKKALLFHASAWGIPGTLTIILLAMNKIEGDNISGVCFVGLYDVHALRYFVLA PLCLDVVVGVSLLLAGIISLNRVRIEIPLEKENQDKLVKFMIRIGVFSILYLVPLLVVIG CYFYEQAYRGVWETTWVQERCREYHIPCPYKVTQTSRPDLILFLMKYLMLLVVGIPSVFW VGSKKTCFEWASFFHGRKKKAGVNESRQVLQEPDFAQSLLRDPNTPIVRKSRGTSTQGTS THASSTQLAMLDDQRSKAGSVQSKVSSYHGSLHRSRDGRYTPCSYRGIEERLPHGSMSHL TDHSRHSSTHRLNEQSHQGSIRDLSNPLAHISHGTSMNRVIEADATSA
Uniprot No.

Target Background

Function
Frizzled-3 (Fzd3) is a receptor for Wnt proteins. The majority of Frizzled receptors are linked to the canonical beta-catenin signaling pathway, which triggers the activation of Dishevelled proteins, inhibition of GSK-3 kinase, nuclear accumulation of beta-catenin, and activation of Wnt target genes. A secondary signaling pathway involving PKC and calcium fluxes has been observed for certain family members. However, it remains unclear whether this represents a distinct pathway or integrates with the canonical pathway, as PKC appears to be necessary for Wnt-mediated inactivation of GSK-3 kinase. Both pathways likely involve interactions with G-proteins. Activated by Wnt8, Fzd3 plays a role in transducing and intercellularly transmitting polarity information during tissue morphogenesis and/or in differentiated tissues. It is involved in regulating early axon growth and guidance processes essential for the formation of specific central and peripheral major fiber tracts. Fzd3 participates in the migration of cranial neural crest cells and may also be implicated in the transmission of sensory information from the trunk and limbs to the brain. It controls commissural sensory axons guidance after midline crossing along the anterior-posterior axis in the developing spinal cord through a Wnt-dependent signaling pathway. In conjunction with FZD6, it contributes to neural tube closure and plays a role in regulating the establishment of planar cell polarity (PCP). Fzd3 promotes neurogenesis by maintaining sympathetic neuroblasts within the cell cycle in a beta-catenin-dependent manner.
Gene References Into Functions
  1. Loss of Fzd3 results in severe malformations of the developing eye. This defect is phenocopied by loss of the activated leukocyte cell adhesion molecule (Alcam). PMID: 28427856
Database Links

KEGG: xla:399190

UniGene: Xl.42572

Protein Families
G-protein coupled receptor Fz/Smo family
Subcellular Location
Membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein. Cell surface. Apical cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expression restricted to the early nervous system.

Q&A

Advanced Research Questions

  • How does Frizzled-3 mediate both canonical and non-canonical Wnt signaling in Xenopus?

    Frizzled-3 demonstrates pathway-specific signaling capabilities in Xenopus:

    • Non-canonical predominance: In Xenopus, Fzd3 primarily activates non-canonical Wnt pathways, particularly during neural crest induction and eye development . The JNK pathway appears to be a key downstream effector, as treatment with JNK inhibitor SP600125 during early eye development results in a small eye phenotype similar to Fzd3 inhibition .

    • Context-dependent signaling: Recent structural studies with nanobody modulators reveal that Fzd3 can participate in β-catenin signaling under specific conditions. A nanobody (Nb8) fused with the Dickkopf-1 C-terminal domain behaves as a Fzd3-specific Wnt surrogate, activating β-catenin signaling .

    • Structural determinants: The crystal structure of Nb8 in complex with the Fzd3 cysteine-rich domain (CRD) shows binding at the base of the lipid-binding groove, indicating how modulators can alter signaling outcomes . The cryo-EM structure of Fzd3 with Nb9 reveals a transmembrane conformation resembling active GPCRs, providing insight into signal transduction mechanisms .

    The pathway choice appears to depend on:

    1. Available co-receptors (LRP5/6 vs. ROR2)

    2. Specific Wnt ligand (Wnt1 vs. Wnt4)

    3. Cellular context and developmental timing

  • What are the mechanisms by which Frizzled-3 regulates neural crest development in Xenopus?

    Frizzled-3 employs several molecular mechanisms to regulate neural crest development:

    • Wnt1-specific interaction: Fzd3 specifically enhances Wnt1 signaling to promote neural crest induction. This specificity is critical, as overexpression of Fzd3 induces neural crest in ectodermal explants and embryos, similar to Wnt1 .

    • Cell-autonomous function: Loss of Fzd3 function, either by morpholino depletion or expression of inhibitory forms (Nfz3), prevents Wnt1-dependent neural crest induction in ectodermal explants and blocks neural crest formation in whole embryos . This demonstrates that Fzd3 functions cell-autonomously within neural crest precursors.

    • Transcriptional regulation: Fzd3-mediated signaling regulates the expression of neural crest specifier genes. The pathway appears to be independent of β-catenin, suggesting a non-canonical mechanism .

    • Dose-dependent effects: Low levels of Fzd3 expression synergize with Wnt1 in neural crest induction, indicating a concentration-dependent signaling threshold .

    Experimental approaches to study this mechanism include:

    • Co-injecting β-galactosidase RNA for lineage tracing with Red-Gal substrate

    • Using dominant-negative forms of Fzd3 (Nfz3) consisting of soluble extracellular domains

    • Targeted morpholino knockdown followed by phenotypic analysis

  • How does the structure of Xenopus Frizzled-3 relate to its function in Wnt binding and signal transduction?

    The structure-function relationship of Xenopus Fzd3 reveals important insights:

    • CRD domain specificity: The cysteine-rich domain (CRD) of Fzd3 contains specific residues that determine Wnt ligand binding specificity. Crystal structures show that nanobodies binding at the base of the lipid-binding groove can compete with Wnt5a .

    • Transmembrane conformation: Cryo-EM structures reveal that the transmembrane conformation of Fzd3 resembles active GPCRs, with partially resolved density for the CRD exhibiting positional flexibility . This supports the model that Fzd3 can function as a GPCR in signal transduction.

    • Intracellular binding surfaces: The cytoplasmic region of Fzd3 contains binding sites for downstream effectors like Dishevelled (DVL) and G proteins. Nanobody binding to this region competes with DVL binding and inhibits GαS coupling, revealing potential mechanisms for pathway specificity .

    • Dimerization: Some studies suggest that Xenopus Fzd3 (Xfz3) dimerizes to activate canonical signaling, while other Frizzled proteins like Fzd7 remain monomeric . This structural feature may contribute to pathway selection.

    These structural insights provide potential targets for developing pathway-specific modulators of Fzd3 signaling.

  • How does Frizzled-3 signaling intersect with other developmental pathways in Xenopus?

    Fzd3 signaling integrates with multiple developmental regulatory networks:

    • Planar Cell Polarity: In Xenopus neuroectoderm, Fzd3 inhibits Vangl2-Prickle3 association to establish planar cell polarity. This inhibition requires Fzd3-dependent Vangl2 phosphorylation . This mechanism is essential for proper neural tube formation and neural crest migration.

    • Transcription factor networks: Fzd3 activation regulates the expression of key transcription factors involved in eye development, including Pax6, Rx, and Otx2 . These factors form a regulatory network that controls eye field specification and differentiation.

    • Non-canonical Wnt pathways: Fzd3 activates JNK signaling during eye development, establishing a link between Wnt-Fzd3 interaction and MAPK cascades .

    • Wnt/β-catenin inhibition: The secreted Frizzled-related protein Sizzled from Xenopus laevis antagonizes Wnt signaling. Structural studies show that its NTR domain occludes the groove of CRD for Wnt accessibility . This suggests potential cross-regulation between different Frizzled-related proteins.

    Understanding these pathway intersections is crucial for interpreting the broader developmental consequences of Fzd3 manipulation.

  • What are the current challenges in optimizing recombinant Xenopus Fzd3 for structural and functional studies?

    Researchers face several challenges when working with recombinant Xenopus Fzd3:

    • Protein folding and stability: As a seven-transmembrane domain receptor, Fzd3 presents challenges for proper folding and stability when expressed recombinantly. The BacMam expression system has proven effective, but optimization is still required for specific applications .

    • Post-translational modifications: Proper glycosylation and disulfide bond formation are essential for Fzd3 function. Different expression systems (E. coli, insect cells, mammalian cells) produce proteins with varying modification patterns .

    • Functional reconstitution: Reconstituting Fzd3 in artificial membranes or detergent micelles while maintaining native activity remains challenging for biophysical studies.

    • Structural flexibility: Cryo-EM studies reveal that the CRD of Fzd3 exhibits positional flexibility , complicating structural analysis but highlighting the dynamic nature of the receptor.

    • Ligand complexity: Producing active Wnt ligands for functional studies of Fzd3 is notoriously difficult due to their lipid modifications and poor solubility.

    Current approaches to address these challenges include:

    1. Using nanobody modulators to stabilize specific conformations

    2. Domain-specific expression for focused structural studies

    3. Creating fusion proteins to enhance expression and stability

    4. Employing cell-based assays like the TOPflash/FOPflash luciferase system to assess functionality

  • How do Frizzled-3 knockout or loss-of-function phenotypes in Xenopus compare to those in other model organisms?

    Comparative analysis of Fzd3 loss-of-function across species reveals evolutionary conservation and divergence:

    SpeciesLoss-of-Function MethodPhenotypeReference
    XenopusMorpholino oligonucleotidesLoss of neural crest induction
    XenopusDominant-negative Fzd3Suppression of endogenous Pax6, Rx, and Otx2 expression; suppression of eye development
    MouseKnockout (-/-)Not directly described in search results
    HumanVariantsSuggested roles in schizophrenia susceptibility

    In Xenopus, Fzd3 loss-of-function specifically affects:

    • Neural crest formation

    • Eye development

    • Axonal pathfinding

    While not fully detailed in the provided search results, mouse studies have shown that Fzd3 null mice demonstrate axon guidance defects in the central nervous system, with some vestibular afferents projecting incorrectly . This suggests evolutionary conservation of Fzd3's role in neuronal development.

    The relatively mild phenotypes in some contexts may reflect functional redundancy among frizzled family members, which include at least ten receptors in vertebrates. This redundancy appears to be tissue-specific, with Fzd3 playing non-redundant roles in neural crest and eye development in Xenopus.

  • What are the most effective experimental designs for studying Frizzled-3 function in Xenopus embryos?

    Optimized experimental approaches for studying Fzd3 function include:

    1. Embryo manipulation and microinjection protocols:

    • Dejelly fertilized eggs with 2% L-cysteine-HCl solution (pH 7.8)

    • Incubate in 1/10 x Steinberg's solution at 14-20°C

    • Stage according to Nieuwkoop and Faber staging series

    • Perform targeted microinjections at specific blastomeres

    2. Gain-of-function approaches:

    • Overexpress wild-type Fzd3 by RNA injection

    • Use inducible expression systems (heat-shock promoters) for temporal control

    • Apply Wnt/β-catenin signaling agonists (CHIR-99021) to test pathway interactions

    3. Loss-of-function strategies:

    • Morpholino antisense oligonucleotides against Fzd3

    • Dominant-negative Fzd3 CRD constructs

    • Overexpression of proteins that interact with Fzd3 intracellular domains (e.g., Kermit)

    4. Visualization techniques:

    • In situ hybridization with Fzd3 probes labeled with fluorescein-substituted nucleotides

    • Co-injection of lineage tracers (β-galactosidase) with Red-Gal substrate

    • Immunostaining with specific antibodies

    5. Functional readouts:

    • Dual-luciferase reporter assays to measure Wnt signaling activity

    • Analysis of marker gene expression (Pax6, Rx, Otx2)

    • Phenotypic assessment of neural crest, eye, and heart development

    • Explant assays to test tissue-specific induction capabilities

    These approaches can be combined in complementary ways to provide robust evidence for Fzd3 function in specific developmental contexts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.