Recombinant Xenopus laevis Frizzled-8 (fzd8)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
fzd8; fz8; Frizzled-8; Fz-8; Xfz8
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
24-581
Protein Length
Full Length of Mature Protein
Species
Xenopus laevis (African clawed frog)
Target Names
Target Protein Sequence
KELSCQEITVPLCKDIGYNYTYMPNQFNHDTQDEAGMEVHQFWPLVVIHCSPDLKFFLCS MYTPICLEDYKKPLPPCRSVCERARAGCAPLMRQYGFAWPDRMRCDRLPEQGNPDTLCMD YYNRTEQTTAAPSHPEPPKPPARSVPKGRTRVEPPRSRSRATGCESGCQCRAPMVQVSNE RHPLYNRVRTGQIPNCAMPCHNPFFSPEERTFTEFWIGLWSVLCFASTFATVSTFLIDME RFKYPERPIIFLSACYLLVSTGYLIRLIAGHEKVACSRGELDLEHIIHYETTGPALCTLV FLLIYFFGMASSIWWVILSLTWFLAAGMKWGNEAIAGYSQYFHLAAWLVPSIKSIAVLAL SSVDGDPVAGICFVGNQNLDNLRGFVLAPLVIYLFIGSMFLLAGFVSLFRIRSVIKQGGT KTDKLEKLMIRIGIFSVLYTVPATIVVACFFYEQHNRQGWEVAHNCNSCQPEMAQPHRPD YAVFMLKYFMCLVVGITSGVWIWSGKTLESWRAFCTRCCWGSKATGGSMYSDVSTGLTWR SGTGSSVSCPKQMPLSQV
Uniprot No.

Target Background

Function
Frizzled-8 (FZD8) is a receptor for Wnt proteins. Most Frizzled receptors are coupled to the canonical beta-catenin signaling pathway, activating disheveled proteins, inhibiting GSK-3 kinase, promoting beta-catenin nuclear accumulation, and ultimately activating Wnt target genes. A secondary pathway involving PKC and calcium fluxes has been observed in some family members; however, its relationship to the canonical pathway remains unclear, as PKC appears necessary for Wnt-mediated GSK-3 kinase inactivation. Both pathways appear to involve G-protein interactions. FZD8 may play a role in transducing and transmitting polarity information during tissue morphogenesis and/or in differentiated tissues. Activation by Wnt8, Wnt5A, or Wnt3A induces expression of beta-catenin target genes and exhibits axis-inducing activity.
Gene References Into Functions
  1. Data suggest that Sizzled is unlikely to antagonize Wnt signaling; however, its structure provides insights into the full-length structure of secreted Frizzled-related proteins like Frizzled-8 and their interactions with and antagonism of Wnt proteins such as Wnt-8. PMID: 28808056
Database Links

KEGG: xla:373690

UniGene: Xl.293

Protein Families
G-protein coupled receptor Fz/Smo family
Subcellular Location
Membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein.

Q&A

What is the basic structure of Xenopus Frizzled-8?

Xenopus Frizzled-8 (Xfz8) is a seven-transmembrane (7TM) glycoprotein receptor of the Frizzled family. Its structure includes an N-terminal signal peptide, a cysteine-rich extracellular domain (CRD) that serves as the primary Wnt-binding region, a seven-transmembrane region, and a C-terminal cytoplasmic domain containing a PDZ binding motif. The CRD is highly conserved among Frizzled family members and forms a distinctive binding interface with Wnt ligands .

How does Xenopus Frizzled-8 compare structurally to mammalian homologs?

Xenopus Frizzled-8 shares significant structural homology with mammalian counterparts. Within the extracellular cysteine-rich domain (amino acids 28-172), human Frizzled-8 shares 85% amino acid identity with zebrafish Frizzled-8 and 90% with Xenopus Frizzled-8 . This high conservation facilitates cross-species studies and suggests evolutionary preservation of critical functional domains. The structural conservation particularly in the CRD allows for similar binding mechanisms with Wnt ligands across species .

What are the binding interactions between Xenopus Frizzled-8 and Wnt ligands?

Structural studies of Xenopus Wnt8 in complex with mouse Frizzled-8 CRD at 3.25 angstrom resolution reveal a distinctive two-domain interaction resembling a "hand" (Wnt) with extended "thumb" and "index" fingers grasping the Frizzled-8 CRD at two distinct binding sites. The first binding site involves a palmitoleic acid lipid group projecting from serine 187 at the tip of Wnt's "thumb" into a deep groove in the Frizzled-8 CRD. The second binding site features the conserved tip of Wnt's "index finger" forming hydrophobic amino acid contacts with a depression on the opposite side of the Frizzled-8 CRD . These interactions demonstrate the complex molecular recognition mechanism between Wnts and Frizzled receptors.

What expression systems are optimal for producing functional recombinant Xenopus Frizzled-8?

For producing functional recombinant Xenopus Frizzled-8, mammalian expression systems (particularly HEK293 cells) are preferred due to their ability to perform proper post-translational modifications essential for Frizzled-8 functionality. When designing expression constructs, researchers should consider incorporating sequences that facilitate proper protein folding of the cysteine-rich domain, which contains multiple disulfide bonds. For functional studies, constructs containing an Fc-fusion tag at the C-terminus (similar to commercially available human Frizzled-8 Fc Chimera proteins) can provide enhanced solubility and simplified purification via protein A/G affinity chromatography .

How can recombinant Xenopus Frizzled-8 binding activity be measured?

Recombinant Xenopus Frizzled-8 binding activity can be quantified using functional ELISAs similar to those established for human Frizzled-8. A typical protocol involves:

  • Coating microplates with biotinylated recombinant Wnt proteins (particularly Wnt-3a or Wnt-5a) at concentrations of 50-100 ng/mL

  • Adding dilutions of recombinant Frizzled-8 Fc chimera (0.1-8,000 ng/mL)

  • Detecting binding using appropriate antibodies and substrates

Optimal binding response typically occurs at concentrations of 7-28 ng/mL for the receptor, though this should be empirically determined for Xenopus Frizzled-8 specifically . Additionally, surface plasmon resonance (SPR) and bio-layer interferometry (BLI) can provide real-time binding kinetics data with purified proteins.

What methods are available for studying Xenopus Frizzled-8 in developmental contexts?

For studying Xenopus Frizzled-8 in developmental contexts, several methodological approaches are available:

MethodApplicationStrengthsLimitations
mRNA microinjectionGain-of-functionRapid expression, titratableTransient expression
Morpholino knockdownLoss-of-functionSpecific targetingPotential off-target effects
CRISPR/Cas9 gene editingGenetic knockoutPermanent modificationPotential lethality
Dominant-negative constructsPathway inhibitionTargets specific domainsMay affect related receptors
In situ hybridizationExpression patternsSpatial informationLimited to transcript detection

When overexpressing Xfz8 mRNA in ventral marginal zone cells, injection at the eight-cell stage has been shown to induce secondary body axis with prominent head structures, demonstrating its developmental activity . Similarly, targeted expression of dominant-negative forms consisting of soluble extracellular domains can suppress endogenous eye development .

How do canonical versus non-canonical signaling pathways differ downstream of Xenopus Frizzled-8 activation?

Frizzled-8 activation can trigger both canonical and non-canonical signaling cascades, with specific outcomes dependent on cellular context:

Canonical Pathway:

  • Activation leads to β-catenin stabilization and nuclear translocation

  • Results in transcriptional activation of TCF/LEF target genes

  • Critical for dorsal axis specification in Xenopus

  • Blocked by co-expression of GSK3β, confirming pathway specificity

Non-canonical Pathways:

  • Can activate planar cell polarity (PCP) signaling involving Dishevelled, RhoA, and JNK

  • May trigger calcium mobilization and protein kinase C activation

  • Often regulates cell movements during gastrulation

  • Can be assessed by analyzing convergent extension movements in animal cap explants

The pathway selection appears to depend on both the specific Wnt ligand and the cellular competence of the responding tissue, as demonstrated by differential activation of dorsal marginal zone markers in animal pole cells versus ventral marginal zone cells in response to Xfz8 .

What are the key protein-protein interaction domains in Xenopus Frizzled-8 and their functional significance?

Xenopus Frizzled-8 contains several critical protein-protein interaction domains:

  • Cysteine-Rich Domain (CRD): Primary site for Wnt ligand binding; mutations in conserved cysteines disrupt proper folding and Wnt recognition

  • Seven-Transmembrane Domain: Implicated in Frizzled dimerization and potentially in G-protein coupling; specific residues in transmembrane helices likely mediate signal transduction

  • C-terminal PDZ-Binding Motif: Interacts with PDZ domain-containing proteins; in related Frizzled receptors (Xfz3), this domain interacts with Kermit, an intracellular PDZ-domain protein that may be required for signal transduction

  • Intracellular Loops: Potential sites for interaction with Dishevelled and other signaling mediators

These interaction domains provide multiple points for experimental manipulation, including targeted mutations or domain swaps to investigate specific signaling outputs.

How do tissue-specific factors influence Xenopus Frizzled-8 signaling outcomes during development?

Tissue-specific factors dramatically influence Frizzled-8 signaling outcomes as evidenced by differential responses in various embryonic tissues:

  • Competence Factors: When Xfz8 is overexpressed in animal pole cells, dorsal marginal zone markers Xnr3, Xotx2, and Siamois are selectively activated, while ventral marginal zone cells respond differently, demonstrating context-dependent signaling

  • Temporal Regulation: Frizzled-8 signaling appears to function at multiple developmental stages - first during organizer induction and subsequently during implementation of organizer functions in dorsoanterior development

  • Co-receptor Availability: The presence or absence of co-receptors like LRP5/6 likely influences whether canonical or non-canonical pathways are activated

  • Expression of Intracellular Effectors: The complement of downstream signaling components, including Dishevelled isoforms and transcriptional regulators, shapes ultimate cellular responses

Understanding these tissue-specific modulators is essential for interpreting experimental outcomes when manipulating Frizzled-8 expression or activity in different developmental contexts.

What is the specific role of Frizzled-8 in Xenopus eye development compared to other Frizzled receptors?

While Frizzled-8 is expressed in patterns consistent with a role in Xenopus eye development, detailed studies have particularly implicated Frizzled-3 (Xfz3) in this process. Overexpression of Xfz3 functions cell-autonomously to promote ectopic eye formation and can perturb endogenous eye development . These ectopic eyes exhibit laminar organization similar to endogenous eyes and contain differentiated retinal cell types.

Frizzled-8's role appears to be more broadly associated with organizer function and anterior development, with expression in the organizer at early gastrula stage and in the most anterior ectoderm at later stages . The precise coordination between different Frizzled receptors during eye development represents an important area for comparative investigation, as functional redundancy and specialization likely both contribute to proper eye formation.

How does Frizzled-8 signaling regulate transcription factors required for eye development?

Frizzled signaling regulates key transcription factors essential for eye development:

  • Pax6 Regulation: Frizzled activation precedes ectopic expression of Pax6, a master regulator of eye development; conversely, dominant-negative Frizzled forms suppress endogenous Pax6 expression

  • Rx Expression: Frizzled signaling is required for proper expression of Rx (Retinal homeobox), which is essential for retinal progenitor specification and proliferation

  • Otx2 Induction: Both Frizzled-3 and likely Frizzled-8 contribute to proper Otx2 expression patterns, which are crucial for forebrain and eye development

These transcription factors form a regulatory network, and disruption of Frizzled signaling through dominant-negative constructs results in suppression of their expression and subsequent eye developmental defects. Targeted overexpression of dominant-negative forms results in reduced or malformed eyes (63% of cases) or complete absence of eyes (7% of cases), with only residual disorganized pigment remaining .

What are the methodological approaches for investigating Frizzled-8 contributions to eye field specification?

To investigate Frizzled-8 contributions to eye field specification, researchers employ several specialized techniques:

  • Targeted Microinjections: Injecting mRNA or morpholinos into specific blastomeres at the 8-16 cell stage that contribute to the eye field, combined with lineage tracers (e.g., fluorescent dextrans or β-galactosidase)

  • Eye Field Transplantation: Excising presumptive eye fields from donor embryos expressing modified Frizzled-8 constructs and transplanting into host embryos to assess autonomous and non-autonomous effects

  • Animal Cap Assays: Treating animal cap explants with combinations of factors including recombinant Wnt proteins and Frizzled-8 to assess induction of eye field markers

  • Dominant-Negative Approaches: Using soluble inhibitory forms of Frizzled-8 (like Nxfz8, consisting of just the extracellular domain) to block endogenous signaling

  • Conditional Expression Systems: Employing heat-shock or hormone-inducible promoters to control timing of Frizzled-8 expression or inhibition during specific developmental windows

These approaches can be complemented with molecular analyses of eye field transcription factor expression and subsequent morphological assessments of eye development.

What are common challenges in producing functional recombinant Xenopus Frizzled-8 and how can they be addressed?

Researchers frequently encounter several challenges when producing recombinant Xenopus Frizzled-8:

ChallengeCauseSolution
Poor expression levelsToxicity of transmembrane proteinUse inducible expression systems; optimize codon usage
Improper foldingMultiple disulfide bonds in CRDInclude chaperone co-expression; slow induction at lower temperatures
AggregationHydrophobic transmembrane domainsExpress soluble CRD domain only; use detergent screening for full-length
Low activityPost-translational modification issuesUse mammalian expression systems; verify glycosylation patterns
Variable binding assay resultsHeterogeneity in Wnt preparationsStandardize Wnt proteins; use appropriate positive controls

When measuring binding activity in functional assays, researchers should establish standard curves using well-characterized reagents and determine optimal concentrations empirically for each application, as concentrations that produce 50% optimal binding response typically range from 7-28 ng/mL for related Frizzled receptors .

How can researchers distinguish between specific and non-specific effects when manipulating Frizzled-8 in vivo?

To distinguish between specific and non-specific effects when manipulating Frizzled-8 in vivo, researchers should implement several control strategies:

  • Rescue Experiments: Co-injecting wild-type Frizzled-8 with dominant-negative constructs should rescue phenotypes if effects are specific. This approach has successfully demonstrated specificity in eye development studies

  • Dose-Response Analysis: Perform careful titration experiments to establish dose-dependent relationships

  • Pathway-Specific Readouts: Utilize reporter constructs for specific downstream pathways (e.g., TOPflash for canonical Wnt signaling) to verify on-target effects

  • Temporal Controls: Employ inducible systems to activate or inhibit Frizzled-8 at specific developmental stages to minimize compensatory effects

  • Combinatorial Approaches: Use multiple independent methods to manipulate Frizzled-8 function (e.g., morpholinos, dominant-negative constructs, and CRISPR) to confirm consistent phenotypes

When unexpected phenotypes emerge, researchers should always consider potential cross-reactivity with other Frizzled family members due to structural similarities, particularly in the highly conserved cysteine-rich domain.

What are the appropriate controls for interpreting phenotypes resulting from Frizzled-8 manipulation in Xenopus embryos?

When interpreting phenotypes resulting from Frizzled-8 manipulation, the following controls are essential:

  • Uninjected Controls: Wild-type embryos from the same batch should be maintained under identical conditions

  • Injection Controls: Embryos injected with equivalent amounts of control mRNA (e.g., GFP) to account for injection trauma and RNA toxicity

  • Specificity Controls:

    • Embryos injected with other Frizzled family members to assess receptor specificity

    • Co-injection with downstream pathway components (e.g., GSK3β or dominant-negative Dishevelled) to verify pathway involvement

    • Rescue experiments with increasing doses of wild-type receptor

  • Lineage Tracing: Co-injection with tracers like fluorescent dextran or β-galactosidase to confirm targeting to expected tissues

  • Alternative Loss-of-Function: Comparison of dominant-negative receptor effects with morpholino knockdown or CRISPR knockout phenotypes

When analyzing molecular phenotypes, quantitative PCR for multiple marker genes should be performed to distinguish between specific pathway perturbations and general developmental delays or toxicity.

How can structure-function analysis of Xenopus Frizzled-8 inform therapeutic approaches targeting Wnt signaling?

Structure-function analysis of Xenopus Frizzled-8, particularly its interaction with Wnt ligands, provides valuable insights for therapeutic development:

  • The detailed structural understanding of Wnt-Frizzled binding interfaces, with palmitoleic acid projecting from Wnt's "thumb" into a groove in the Frizzled CRD, offers specific targets for small molecule or peptide-based inhibitors

  • The conservation of amino acids in both binding interfaces facilitates ligand-receptor cross-reactivity, which has significant implications for developing Wnt-based drugs for cancer and regenerative medicine

  • The recombinant Frizzled CRD has been used experimentally to block Wnt signaling and inhibit growth of teratocarcinomas, demonstrating proof-of-concept for therapeutic applications

Understanding these interactions in the evolutionarily conserved Xenopus model provides translational insights that can be applied to human disease contexts where aberrant Wnt signaling contributes to pathology.

What are unresolved questions regarding Frizzled-8's role in coordinating multiple signaling pathways during development?

Despite significant advances, several unresolved questions remain regarding Frizzled-8's role in developmental signaling:

  • The molecular mechanisms determining whether Frizzled-8 activation triggers canonical versus non-canonical pathways remain incompletely understood

  • The precise role of post-translational modifications (particularly glycosylation) in modulating Frizzled-8 function and ligand selectivity requires further investigation

  • The potential for heterodimer formation between Frizzled-8 and other Frizzled family members, which may generate unique signaling properties, remains largely unexplored

  • The integration of Frizzled-8 signaling with other developmental pathways (Notch, BMP, FGF) at the level of transcriptional regulation represents a complex area for future research

  • The contribution of mechanical forces and tissue architecture to Frizzled-8 distribution and signaling efficiency during morphogenetic movements needs additional study

Addressing these questions will require multidisciplinary approaches combining structural biology, live imaging, and systems-level analysis of signaling networks.

How can emerging technologies enhance our understanding of Frizzled-8 function in development and disease?

Emerging technologies offer promising avenues to advance our understanding of Frizzled-8 biology:

  • CRISPR-based Approaches:

    • Base editing for precise modification of key residues

    • CRISPRi/CRISPRa for temporal control of expression

    • Lineage tracing using CRISPR-Cas9 barcoding to track cell fates

  • Advanced Imaging:

    • Super-resolution microscopy to visualize receptor clustering

    • FRET/BRET sensors to detect conformational changes upon ligand binding

    • Optogenetic tools to control Frizzled-8 signaling with spatial and temporal precision

  • Single-cell Technologies:

    • scRNA-seq to identify cell-type-specific responses to Frizzled-8 signaling

    • Spatial transcriptomics to map signaling domains in developing tissues

    • Multi-omics approaches to integrate transcriptional, epigenetic, and proteomic changes

  • In vitro Modeling:

    • Organoid systems to recapitulate complex developmental processes

    • Microfluidic devices to control Wnt gradient formation

    • Reconstituted signaling systems using purified components

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.