Recombinant Xenopus laevis FUN14 domain-containing protein 1A (fundc1-a)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
fundc1-a; FUN14 domain-containing protein 1A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-151
Protein Length
full length protein
Species
Xenopus laevis (African clawed frog)
Target Names
fundc1-a
Target Protein Sequence
MAARREPSSDDESYEVLDLTDYARRHHWWNRLFGRNSGPLTEKYSVATQIVIGGVSGWCA GFLFQKVGKLAATAVGGGFLLLQIASHGGYIQVDWKRVEKDVNNAKRKIKKEANKSAPEI NTLIEESTDFVKKNIVVSGGFVGGFLLGLAS
Uniprot No.

Target Background

Function
This protein functions as an activator of hypoxia-induced mitophagy, a crucial mechanism for mitochondrial quality control.
Database Links

KEGG: xla:734365

UniGene: Xl.66505

Protein Families
FUN14 family
Subcellular Location
Mitochondrion outer membrane; Multi-pass membrane protein.

Q&A

How can researchers verify the expression and localization of recombinant Xenopus laevis FUNDC1-A?

To verify expression and localization, researchers should employ multiple complementary approaches:

  • Western blotting: Using antibodies against either the FUNDC1 protein or epitope tags (if the recombinant protein is tagged). Cross-reactivity with antibodies raised against mammalian FUNDC1 should be tested.

  • Immunofluorescence microscopy: To confirm mitochondrial localization, co-staining with mitochondrial markers (such as MitoTracker or antibodies against TOMM20) is essential. In properly localized FUNDC1-A, you should observe co-localization with mitochondrial markers.

  • Subcellular fractionation: Isolation of mitochondrial fractions followed by Western blotting can provide biochemical evidence for mitochondrial outer membrane localization.

  • Protease protection assays: These can determine the membrane topology of the protein, which should show that the N-terminal domain faces the cytosol while the C-terminal portion is anchored in the mitochondrial outer membrane, similar to mammalian FUNDC1.

What expression systems are most effective for producing recombinant Xenopus laevis FUNDC1-A?

Several expression systems can be utilized for the production of recombinant Xenopus laevis FUNDC1-A, each with distinct advantages:

  • E. coli expression system:

    • Advantages: High yield, cost-effective, rapid expression

    • Challenges: May form inclusion bodies requiring refolding, lacks post-translational modifications

    • Recommended approach: Use of fusion tags (e.g., MBP, SUMO) to enhance solubility

  • Insect cell expression (baculovirus system):

    • Advantages: Better protein folding, some post-translational modifications

    • Suitable for obtaining membrane proteins in native-like states

    • Higher yields than mammalian cells

  • Mammalian cell expression:

    • Advantages: Most similar post-translational modifications and folding machinery

    • Challenges: Lower yields, higher cost

    • Recommended for functional studies requiring proper phosphorylation

  • Xenopus oocyte expression:

    • Advantages: Native folding environment, appropriate for amphibian proteins

    • Particularly useful for functional studies in the native species context

For structural studies requiring larger quantities, the E. coli or insect cell systems are most appropriate, while functional studies may benefit from mammalian or Xenopus expression systems .

What are the critical considerations for purifying functional recombinant Xenopus laevis FUNDC1-A?

Purification of functional FUNDC1-A requires careful attention to several factors:

  • Detergent selection: As a mitochondrial membrane protein, proper detergent selection is crucial. A comparative analysis of different detergents (CHAPS, DDM, or digitonin) should be performed to identify which best maintains protein structure and function.

  • Buffer optimization:

    • pH considerations: Typically 7.2-8.0 for maintaining stability

    • Salt concentration: Usually 150-300 mM NaCl to maintain solubility

    • Reducing agents: Addition of DTT or β-mercaptoethanol to prevent oxidation of cysteine residues

  • Purification strategy:

    • Affinity chromatography (Ni-NTA for His-tagged proteins)

    • Size exclusion chromatography to ensure monodispersity

    • Ion exchange chromatography for further purification

  • Quality control metrics:

    • SDS-PAGE for purity assessment (>90% purity recommended)

    • Circular dichroism to verify secondary structure

    • Dynamic light scattering to assess aggregation state

    • Functional assays (like LC3 binding) to confirm activity

Maintaining the protein in a phospholipid environment or reconstituting it into nanodiscs or liposomes after purification can help preserve native structure and function .

How can researchers assess the mitophagy-inducing activity of recombinant Xenopus laevis FUNDC1-A in vitro?

Assessment of mitophagy-inducing activity requires multiple complementary approaches:

  • LC3 binding assays:

    • GST pulldown or co-immunoprecipitation to assess binding to LC3

    • Surface plasmon resonance or microscale thermophoresis to quantify binding affinity

    • Comparative analysis with mammalian FUNDC1 as reference

  • Mitophagy flux measurement:

    • Transfection of recombinant FUNDC1-A into mammalian cells followed by mitophagy induction (e.g., CCCP treatment or hypoxia)

    • Quantification of mitochondrial mass using MitoTracker or antibodies against mitochondrial proteins

    • Western blot analysis of mitophagy markers (e.g., PINK1, Parkin recruitment)

  • Reconstituted in vitro systems:

    • Reconstitution of FUNDC1-A into liposomes with fluorescently labeled LC3

    • Measuring LC3 recruitment to FUNDC1-A-containing membranes

    • Assessing the impact of phosphorylation on this recruitment

  • Xenopus oocyte or embryo mitophagy assays:

    • Microinjection of recombinant FUNDC1-A

    • Assessment of mitochondrial clearance under normal and hypoxic conditions

    • Comparison with endogenous FUNDC1-A activity

A comparative analysis table should be maintained to document differences between Xenopus FUNDC1-A and mammalian FUNDC1 in these assays .

What phosphorylation sites regulate Xenopus laevis FUNDC1-A activity and how can they be studied?

Based on mammalian FUNDC1 studies, several phosphorylation sites are likely critical for regulating Xenopus laevis FUNDC1-A activity. A methodological approach to their study includes:

  • Sequence alignment analysis:

    • Identify conserved residues corresponding to mammalian FUNDC1's Tyr18, Ser13, and Ser17

    • Predict additional amphibian-specific phosphorylation sites using tools like NetPhos or PhosphoSitePlus

  • Site-directed mutagenesis:

    • Generate phosphomimetic (S→D or Y→E) and phosphodeficient (S→A or Y→F) mutants

    • Express and purify these mutants for comparative functional studies

  • Mass spectrometry analysis:

    • Map phosphorylation sites under different conditions (normoxia vs. hypoxia)

    • Quantify phosphorylation stoichiometry using stable isotope labeling

  • Kinase and phosphatase identification:

    • In vitro kinase assays to identify relevant kinases (likely candidates include SRC, CK2, PGAM5 based on mammalian studies)

    • Phosphatase assays to identify enzymes responsible for dephosphorylation

  • Functional consequences:

    • LC3 binding assays with phosphorylation site mutants

    • Mitophagy assays in cellular systems expressing phosphorylation site mutants

Potential Phosphorylation SiteCorresponding Site in Mammalian FUNDC1Predicted Regulatory EffectSuggested Experimental Approach
Tyr18 (predicted)Tyr18Inhibits LC3 binding when phosphorylatedPhosphomimetic vs. phosphodeficient mutations, LC3 binding assays
Ser13 (predicted)Ser13Inhibits LC3 binding when phosphorylatedSRC kinase assays, hypoxia response testing
Ser17 (predicted)Ser17Inhibits LC3 binding when phosphorylatedCK2 kinase assays, PGAM5 dephosphorylation assays

This systematic approach will help elucidate the regulatory mechanisms specific to Xenopus FUNDC1-A .

How does Xenopus laevis FUNDC1-A contribute to understanding the evolutionary conservation of mitophagy mechanisms?

Xenopus laevis FUNDC1-A provides valuable insights into the evolutionary conservation of mitophagy mechanisms across vertebrates:

  • Phylogenetic analysis approaches:

    • Construction of phylogenetic trees using FUN14 domain sequences from diverse species

    • Analysis of selection pressure (dN/dS ratio) across different lineages

    • Identification of conserved motifs using tools like MEME and GLAM2

  • Functional conservation assessment:

    • Complementation experiments replacing mammalian FUNDC1 with Xenopus FUNDC1-A

    • Comparative analysis of LC3 binding affinity and specificity

    • Evaluation of response to stimuli like hypoxia across species

  • Developmental role investigation:

    • Expression pattern analysis during different developmental stages

    • Morpholino knockdown or CRISPR/Cas9 approaches to assess developmental phenotypes

    • Rescue experiments with mammalian FUNDC1

The FUN14 domain is ancient, appearing in archaea, bacteria, and eukaryotes, indicating fundamental cellular functions conserved over billions of years of evolution . Understanding how Xenopus FUNDC1-A functions compared to mammalian FUNDC1 can reveal which aspects of mitophagy regulation are evolutionarily constrained versus those that have adapted to specific physiological contexts.

How can recombinant Xenopus laevis FUNDC1-A be used to study mitophagy in developmental contexts?

Xenopus embryos provide an excellent model for studying developmental mitophagy, with several methodological approaches:

  • Temporal expression profiling:

    • qRT-PCR and Western blotting to assess FUNDC1-A expression across developmental stages

    • In situ hybridization to determine tissue-specific expression patterns

    • Correlation with mitochondrial biogenesis markers

  • Loss-of-function studies:

    • Morpholino oligonucleotide injection for transient knockdown

    • CRISPR/Cas9 genome editing for stable genetic manipulation

    • Phenotypic assessment focusing on tissues with high mitochondrial content (muscle, heart, brain)

  • Gain-of-function and rescue experiments:

    • Microinjection of mRNA encoding wild-type or mutant FUNDC1-A

    • Rescue experiments with recombinant protein

    • Time-lapse imaging of mitophagy in developing embryos

  • Environmental stress responses:

    • Assessment of hypoxia-induced mitophagy in developing embryos

    • Temperature variation experiments to understand poikilotherm-specific adaptations

    • Metabolic stress induction and monitoring of mitochondrial quality control

These approaches can help elucidate how mitophagy is regulated during critical developmental transitions, particularly during periods of rapid cell division and differentiation when mitochondrial quality control is essential .

What approaches can be used to study the role of FUNDC1-A in Xenopus laevis heart development and function?

Based on mammalian studies showing FUNDC1's importance in cardiac function, several approaches can be employed to study Xenopus laevis FUNDC1-A in heart development:

  • Expression pattern analysis:

    • Whole-mount in situ hybridization for FUNDC1-A during cardiac development

    • Immunohistochemistry to detect protein localization in developing and mature hearts

    • qRT-PCR for quantitative expression in microdissected heart tissue

  • Functional perturbation:

    • Targeted CRISPR/Cas9 knockout in cardiac progenitors

    • Morpholino oligonucleotide knockdown with cardiac-specific phenotype assessment

    • Dominant-negative construct overexpression by mRNA injection

  • Mitochondrial dynamics assessment:

    • Live imaging of mitochondrial networks in developing hearts using fluorescent reporters

    • Electron microscopy to visualize mitochondrial ultrastructure and mitophagy events

    • Assessment of mitochondria-ER contacts by proximity ligation assays

  • Functional consequences:

    • Optical mapping of calcium transients in control versus FUNDC1-A-depleted hearts

    • Heart rate and contractility measurements

    • Hypoxia/reoxygenation challenge experiments

  • Molecular pathway analysis:

    • Investigation of CREB phosphorylation status and transcriptional outputs

    • Analysis of Fis1 expression and mitochondrial fission rates

    • Assessment of calcium homeostasis at ER-mitochondria contact sites

These approaches can help determine whether FUNDC1-A regulates ER-mitochondria contacts and calcium homeostasis in Xenopus hearts similar to its role in mammalian systems .

Is Xenopus laevis FUNDC1-A regulated by PGC-1α/NRF1 similar to mammalian FUNDC1?

To investigate the regulation of Xenopus laevis FUNDC1-A by the PGC-1α/NRF1 pathway, researchers should consider:

  • Promoter analysis:

    • Bioinformatic identification of potential NRF1 binding sites in the Xenopus FUNDC1-A promoter

    • Comparison with the conserved NRF1 binding element found in mammalian FUNDC1 promoters

    • Reporter assays to test functionality of identified sites

  • Protein-DNA interaction studies:

    • Chromatin immunoprecipitation (ChIP) assays to detect NRF1 binding to the FUNDC1-A promoter

    • Electrophoretic mobility shift assays (EMSA) with purified Xenopus NRF1 protein

    • DNase I footprinting to precisely map binding regions

  • Expression correlation studies:

    • PGC-1α overexpression in Xenopus cells or embryos followed by FUNDC1-A expression analysis

    • siRNA knockdown of PGC-1α or NRF1 and assessment of FUNDC1-A levels

    • Quantitative analysis across tissues with varying levels of PGC-1α activity

  • Functional implications:

    • Assessment of FUNDC1-A expression during cold adaptation or metamorphosis (periods of heightened PGC-1α activity)

    • Correlation with other NRF1 target genes

    • Integration with mitochondrial biogenesis pathways

In mammals, the PGC-1α/NRF1 axis directly regulates FUNDC1 expression, coupling mitophagy with mitochondrial biogenesis . This regulatory relationship may be conserved in Xenopus, particularly in tissues undergoing metabolic adaptation or remodeling.

How does temperature affect the structure and function of Xenopus laevis FUNDC1-A in mitophagy regulation?

As poikilotherms, Xenopus laevis must adapt mitochondrial quality control to varying environmental temperatures. To study temperature effects on FUNDC1-A:

  • Structural stability assessment:

    • Circular dichroism spectroscopy at different temperatures (5-30°C)

    • Differential scanning calorimetry to determine thermal transition points

    • Comparison with mammalian FUNDC1 stability profiles

  • Temperature-dependent interaction studies:

    • LC3 binding assays at different temperatures

    • Co-immunoprecipitation experiments across temperature ranges

    • Surface plasmon resonance with temperature as a variable

  • Cellular mitophagy assays:

    • Xenopus cell culture at different temperatures followed by mitophagy assessment

    • Temperature shift experiments to simulate natural environmental changes

    • Quantification of mitophagy flux using microscopy and biochemical methods

  • Phosphorylation kinetics:

    • In vitro kinase and phosphatase assays at different temperatures

    • Phosphorylation site mapping at low versus high temperatures

    • Correlation with functional changes in mitophagy activity

  • Comparative species analysis:

    • Comparison with FUNDC1 from mammals (homeotherms) and fish (poikilotherms)

    • Identification of temperature-adaptive mutations in the Xenopus sequence

    • Structure-function predictions based on species-specific differences

This research would provide insight into how poikilotherms maintain mitochondrial quality control across varying environmental conditions, potentially revealing temperature-adaptive features of the mitophagy machinery.

What methodologies are most effective for studying the interaction between Xenopus laevis FUNDC1-A and mitochondrial membranes?

Several advanced techniques can effectively characterize FUNDC1-A interactions with mitochondrial membranes:

  • Reconstitution systems:

    • Proteoliposomes with defined lipid compositions mimicking mitochondrial outer membranes

    • Nanodiscs containing purified FUNDC1-A for single-molecule studies

    • Giant unilamellar vesicles (GUVs) for membrane dynamics visualization

  • Membrane topology mapping:

    • FRET analysis with specific domain-targeted fluorophores

    • Accessibility studies using membrane-impermeable chemical modifiers

    • Cryo-electron microscopy of membrane-embedded FUNDC1-A

  • Lipid interaction analysis:

    • Liposome flotation assays to assess membrane binding

    • Lipid strip assays to identify specific lipid interactions

    • Hydrogen-deuterium exchange mass spectrometry to map membrane-interacting regions

  • Lateral mobility assessment:

    • Fluorescence recovery after photobleaching (FRAP) of tagged FUNDC1-A

    • Single-particle tracking to analyze diffusion behavior

    • Super-resolution microscopy to visualize nanoscale organization

  • Membrane curvature effects:

    • Assays with membranes of varying curvature (SUVs vs. LUVs)

    • Assessment of FUNDC1-A enrichment at membrane contact sites

    • Analysis of local membrane deformation induced by FUNDC1-A clustering

These methodologies can help determine how FUNDC1-A is oriented in the membrane, what lipids it preferentially interacts with, and how these interactions influence its mitophagy receptor function .

How can researchers effectively distinguish between FUNDC1-A-mediated mitophagy and other mitophagy pathways in Xenopus systems?

Distinguishing FUNDC1-A-mediated mitophagy from other pathways requires specific experimental strategies:

Mitophagy PathwayPrimary StimulusKey MarkersDistinguishing Features
FUNDC1-A-mediatedHypoxiaDephosphorylated FUNDC1-A, LC3 recruitmentHypoxia-enhanced, independent of ubiquitination
PINK1/ParkinCCCP, membrane depolarizationPINK1 stabilization, Parkin recruitment, ubiquitinationUbiquitin-dependent, requires mitochondrial depolarization
NIX/BNIP3Developmental cues, hypoxiaNIX/BNIP3 upregulationOften transcriptionally regulated by HIF-1α
Cardiolipin-mediatedROS, membrane permeabilizationExternalized cardiolipinLipid-dependent, enhanced by oxidative stress

This comprehensive approach would allow researchers to specifically attribute mitophagy events to FUNDC1-A versus other pathways .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.