Recombinant Xenopus laevis FUN14 domain-containing protein 1B (fundc1-b)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. You may use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
fundc1-b; FUN14 domain-containing protein 1B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-188
Protein Length
full length protein
Species
Xenopus laevis (African clawed frog)
Target Names
fundc1-b
Target Protein Sequence
MSKKSTNIFTCSGAQHKWIQVVNIDGNIFSIYVCFFVCFFFYLEPSSDDESYEVLDLTEY ARRHHWWNRLFGRNSGPLTEKYSVATQIVIGGVSGWCAGFLFQKVGKLAATAVGGGFLLL QIASHGGYIQIDWKRVEKDVNKAKRKIKKEANKTPEINTVIEKSTDFFKKNIVVSGGFVG GFLIGLAS
Uniprot No.

Target Background

Function
Functions as an activator of hypoxia-induced mitophagy, a critical process for mitochondrial quality control.
Database Links

KEGG: xla:446354

UniGene: Xl.36062

Protein Families
FUN14 family
Subcellular Location
Mitochondrion outer membrane; Multi-pass membrane protein.

Q&A

What is FUN14 Domain-Containing Protein 1B (fundc1-b) and what is its significance in Xenopus laevis research?

Fundc1-b is a mitochondrial membrane protein belonging to the FUN14 domain family expressed in Xenopus laevis. The protein consists of 188 amino acids with a specific FUN14 domain that is evolutionarily conserved across species. Fundc1-b serves as an important model protein for studying mitochondrial dynamics, particularly in amphibian developmental contexts. Its significance in Xenopus research stems from the evolutionary position of amphibians between aquatic vertebrates and land tetrapods, allowing researchers to distinguish between species-specific adaptations and conserved features of biological systems . The recombinant form typically includes a His-tag to facilitate purification and detection in experimental systems .

What are the known functional domains in fundc1-b and their roles in protein activity?

The primary functional region in fundc1-b is the FUN14 domain, which plays a crucial role in mitochondrial interactions and protein-protein binding. Based on homology with human FUNDC1, this domain likely mediates interactions with mitochondrial proteins and potentially participates in mitophagy regulation. The protein contains transmembrane regions that anchor it to the mitochondrial membrane, as evidenced by the hydrophobic amino acid regions in its sequence . These structural features are essential for its localization and function, particularly in cellular stress response pathways. Research on human FUNDC1 suggests involvement in hypoxia-induced mitophagy, which may be conserved in the Xenopus homolog .

What are the optimal conditions for reconstituting recombinant fundc1-b to ensure maximal protein activity?

For optimal reconstitution of lyophilized recombinant fundc1-b, researchers should:

  • Centrifuge the vial briefly before opening to ensure all material is at the bottom.

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL.

  • Add glycerol to a final concentration of 50% to enhance stability for long-term storage.

  • Aliquot the reconstituted protein to avoid repeated freeze-thaw cycles.

  • Store working aliquots at 4°C for up to one week.

The reconstitution buffer (Tris/PBS-based buffer, pH 8.0, with 6% Trehalose) maintains protein stability and functionality . Researchers should verify protein activity after reconstitution through functional assays specific to mitochondrial proteins, such as protein-protein interaction studies or mitochondrial recruitment assays.

How should researchers design control experiments when studying the effects of fundc1-b in Xenopus models?

When investigating fundc1-b functions in Xenopus models, researchers should implement the following controls:

  • Negative controls: Include experiments with denatured fundc1-b or irrelevant proteins with similar tags to distinguish specific from non-specific effects.

  • Dosage controls: Test multiple concentrations of recombinant fundc1-b to establish dose-dependent relationships.

  • Specificity validation: Use RNA interference or CRISPR-based approaches to deplete endogenous fundc1-b, then rescue with recombinant protein to confirm specificity.

  • Tag-only controls: Express and purify the tag portion alone to exclude tag-related artifacts.

These controls are particularly important when studying mitochondrial dynamics or protein-protein interactions in Xenopus systems, which offer unique advantages for developmental biology research due to their conserved yet distinct immune system compared to mammals .

What expression systems yield the highest quality recombinant fundc1-b protein for functional studies?

E. coli expression systems are predominantly used for producing recombinant Xenopus laevis fundc1-b, as demonstrated in commercial preparations . For most functional studies, this bacterial expression system provides sufficient protein quality with the advantages of high yield and cost-effectiveness. The His-tagged protein expressed in E. coli maintains structural integrity suitable for most biochemical and cell-based assays.

  • Insect cell expression systems (baculovirus) which provide more complex post-translational processing.

  • Xenopus oocyte or cell-free systems for proteins that may be toxic to prokaryotic cells.

  • Mammalian cell expression for studies requiring mammalian-specific chaperone assistance.

Each system presents trade-offs between yield, cost, and preservation of native characteristics relevant to specific experimental questions.

How is fundc1-b being utilized to study mitochondrial dynamics in developmental biology?

Fundc1-b serves as an important tool for investigating mitochondrial dynamics during Xenopus development. Researchers employ the following approaches:

  • Protein localization studies: Using tagged recombinant fundc1-b to visualize mitochondrial network changes during key developmental transitions.

  • Interaction mapping: Identifying developmental stage-specific binding partners through co-immunoprecipitation studies with recombinant fundc1-b.

  • Functional perturbation: Microinjecting recombinant protein or morpholinos targeting endogenous fundc1-b to assess developmental consequences.

This research is particularly valuable because Xenopus provides an excellent model for visualizing subcellular processes during development due to its large, externally developing embryos. The evolutionary position of Xenopus between aquatic vertebrates and terrestrial tetrapods makes it ideal for identifying conserved mechanisms of mitochondrial regulation across vertebrates .

What methodologies are most effective for studying protein-protein interactions involving fundc1-b?

Multiple complementary approaches can be employed to comprehensively study fundc1-b interactions:

  • Co-immunoprecipitation (Co-IP): Using His-tag antibodies to pull down recombinant fundc1-b and identify binding partners through mass spectrometry. This technique is effective for detecting stable interactions but may miss transient associations .

  • Proximity labeling: BioID or APEX2 fusions with fundc1-b can identify proteins in close proximity within the cellular environment, providing spatial context to interactions.

  • Yeast two-hybrid screening: While more prone to false positives, this technique can help identify direct binding partners from Xenopus cDNA libraries.

  • Fluorescence resonance energy transfer (FRET): For monitoring interactions in live Xenopus cells or embryos, particularly for studying dynamic associations during developmental processes.

When analyzing interaction data, researchers should consider the cellular compartmentalization of fundc1-b and validate findings across multiple methodologies to ensure reliability.

How can researchers effectively monitor the dynamics of fundc1-b localization and function during mitophagy?

To monitor fundc1-b dynamics during mitophagy in Xenopus systems, researchers can implement these advanced approaches:

  • Live cell imaging with fluorescently tagged fundc1-b: Using constructs expressing fundc1-b fused to fluorescent proteins (GFP/mCherry) to visualize real-time translocation during mitophagy.

  • Mitochondrial membrane potential assays: Employing JC-1 dye alongside fundc1-b visualization to correlate localization with functional mitochondrial changes. The JC-1 aggregate-to-monomer ratio provides quantitative assessment of membrane potential .

  • Super-resolution microscopy: Techniques like STORM or PALM can resolve fundc1-b localization relative to mitochondrial substructures with nanometer precision.

  • Correlative light and electron microscopy (CLEM): Combining fluorescence microscopy of tagged fundc1-b with electron microscopy to visualize ultrastructural context of its localization.

  • Quantitative mitophagy assays: Using mitochondrially-targeted fluorescent proteins with different pH sensitivities to distinguish between mitochondria undergoing mitophagy versus those remaining in the network.

These approaches can be particularly powerful in Xenopus systems due to the large cell size and optical clarity of embryos at many developmental stages .

What genome editing techniques are most suitable for manipulating fundc1-b expression in Xenopus laevis models?

Given the unique genomic characteristics of Xenopus laevis (allotetraploid with duplicated genes), researchers should consider these specialized approaches:

  • CRISPR-Cas9 with multi-guide strategy: Targeting multiple sites simultaneously to address potential genetic redundancy in Xenopus. This requires careful guide RNA design to target conserved regions across duplicated genes.

  • Morpholino antisense oligonucleotides: While having limitations in specificity, morpholinos remain useful for transient knockdown during early developmental stages in Xenopus.

  • Transgenic approaches: Utilizing the Tol2 or I-SceI meganuclease systems for stable integration of fundc1-b constructs (wild-type, mutant, or fluorescently tagged versions).

  • Tissue-specific or inducible expression systems: Using heat shock promoters or tissue-specific promoters to achieve temporal and spatial control of fundc1-b expression.

The Xenopus laevis Research Resource for Immunobiology at the University of Rochester maintains transgenic animals and technical expertise that may assist researchers in implementing these genetic approaches . Verification of genetic modifications should include both molecular analysis (PCR, sequencing) and functional assays specific to mitochondrial dynamics.

What are common issues encountered when working with recombinant fundc1-b and how can they be addressed?

Researchers frequently encounter several challenges when working with recombinant fundc1-b:

  • Protein aggregation: Fundc1-b may form aggregates when stored improperly. To minimize this:

    • Avoid repeated freeze-thaw cycles by preparing single-use aliquots

    • Include 50% glycerol in storage buffer as recommended

    • Store working aliquots at 4°C for no more than one week

  • Loss of activity over time: Mitochondrial membrane proteins can lose functional activity during storage:

    • Perform activity assays before experimental use

    • Compare fresh preparations to stored samples to establish activity retention rates

    • Consider including stabilizing agents like trehalose in storage buffers

  • Non-specific binding: The hydrophobic regions of fundc1-b may cause non-specific interactions:

    • Include appropriate detergents in binding buffers

    • Use stringent washing conditions in pull-down experiments

    • Always include proper controls with unrelated proteins having similar physicochemical properties

  • Expression system limitations: E. coli-expressed fundc1-b lacks post-translational modifications present in native protein:

    • Consider alternative expression systems when studying specific modifications

    • Validate key findings with endogenous protein when possible

How can researchers validate the structural integrity and functionality of recombinant fundc1-b before experimental use?

Before using recombinant fundc1-b in experiments, researchers should verify both structural integrity and functional activity through these complementary approaches:

  • Structural validation:

    • SDS-PAGE to confirm size and purity (>90% is recommended)

    • Circular dichroism spectroscopy to assess secondary structure

    • Limited proteolysis to evaluate folding stability

    • Dynamic light scattering to detect aggregation

  • Functional validation:

    • Binding assays with known interaction partners

    • Mitochondrial recruitment assays in cell-free systems

    • Mitophagy induction capability in reconstitution experiments

    • Comparison with positive controls (e.g., human FUNDC1)

These validations are particularly important when studying hypoxia response pathways, where proper protein folding and activity are essential for meaningful results .

What considerations should be made when designing experiments to study the role of fundc1-b in different Xenopus developmental stages?

When investigating fundc1-b across Xenopus developmental stages, researchers should address these key experimental design considerations:

  • Stage-specific expression profiling:

    • Quantify endogenous fundc1-b expression levels at each developmental stage

    • Compare with other mitochondrial regulatory proteins to establish relative importance

    • Consider potential redundant systems that may mask phenotypes

  • Microinjection timing and dosage:

    • Early injections (1-2 cell stage) for studying maternal effects

    • Later injections for tissue-specific analyses

    • Careful titration of recombinant protein or morpholino doses to avoid off-target effects

  • System complexity considerations:

    • Account for the unique advantages of Xenopus for developmental studies, including large embryo size and external development

    • Design experiments that leverage the conserved yet distinct features of Xenopus compared to mammalian systems

    • Consider the potential influence of oxygen availability on fundc1-b function during aquatic development

  • Technical adaptations:

    • Adjust protein delivery methods based on embryonic stage (microinjection vs. bath application)

    • Modify imaging techniques to accommodate increased tissue complexity in later stages

    • Implement stage-appropriate controls that account for developmental variability

What are promising unexplored aspects of fundc1-b function that warrant further investigation?

Several promising research directions for fundc1-b in Xenopus systems remain unexplored:

  • Metamorphosis-specific functions: Investigating how fundc1-b mediates mitochondrial remodeling during the dramatic tissue reorganization that occurs during tadpole-to-frog transition. This unique developmental process may reveal novel functions not observable in mammalian systems .

  • Environmental stress responses: Exploring how fundc1-b coordinates mitochondrial adaptation to temperature fluctuations, oxygen availability changes, and other environmental stressors relevant to amphibian biology.

  • Immune system interactions: Examining potential roles of fundc1-b in mitochondrial regulation during immune responses, leveraging the similarity yet evolutionary distance between Xenopus and mammalian immune systems .

  • Comparative analysis with fundc1-a: Investigating functional differences between the two fundc1 paralogs in Xenopus to understand sub-functionalization following gene duplication.

  • Interspecies conservation analysis: Conducting comparative studies between Xenopus fundc1-b and human FUNDC1 to identify evolutionarily conserved mechanisms in mitochondrial regulation, particularly in contexts like hypoxia response where human FUNDC1 has established roles .

How might advanced transcriptomics and proteomics approaches enhance our understanding of fundc1-b regulatory networks?

Integrative multi-omics approaches offer powerful tools for unraveling fundc1-b regulatory networks:

  • Single-cell RNA sequencing: Mapping fundc1-b expression patterns across cell types and developmental stages with unprecedented resolution, revealing cell-specific regulatory patterns.

  • Spatial transcriptomics: Preserving spatial information while analyzing gene expression to understand tissue-specific contexts of fundc1-b function.

  • Proximity-dependent biotinylation proteomics: Identifying the complete interactome of fundc1-b in different cellular contexts, revealing condition-specific interaction partners.

  • Post-translational modification profiling: Comprehensive analysis of fundc1-b modifications under different physiological conditions to understand regulatory mechanisms.

  • Integrative network analysis: Combining transcriptomics, proteomics, and functional data to construct comprehensive models of fundc1-b-centered regulatory networks.

These approaches can be particularly revealing when applied to comparative studies between hypoxic and normoxic conditions, where fundc1-b may exhibit specialized functions based on homology with human FUNDC1 .

What potential therapeutic implications might arise from fundamental research on fundc1-b in Xenopus models?

While direct therapeutic applications require translation to human systems, fundamental research on fundc1-b in Xenopus models may inform several therapeutic areas:

  • Cancer therapy approaches: Research on human FUNDC1 has revealed roles in cancer progression and chemoresistance . Xenopus fundc1-b studies may identify conserved mechanisms that could be targeted therapeutically.

  • Mitochondrial disease interventions: Understanding fundamental mechanisms of mitochondrial quality control mediated by fundc1-b might inform approaches to human mitochondrial disorders.

  • Hypoxia-related pathologies: The potential role of fundc1-b in hypoxia response, suggested by studies of human FUNDC1 , may provide insights relevant to ischemic disorders and hypoxic tumor environments.

  • Developmental disorder understanding: Given the importance of proper mitochondrial function during development, insights from fundc1-b studies in Xenopus embryogenesis could illuminate mechanisms underlying certain developmental disorders.

  • Drug screening platforms: Xenopus embryos offer advantages for medium-throughput screening of compounds that modulate mitochondrial dynamics through fundc1-b pathways, potentially identifying lead compounds for therapeutic development.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.