Recombinant Xenopus laevis Gap junction alpha-1 protein (gja1)

Shipped with Ice Packs
In Stock

Description

Molecular Overview

GJA1 (Connexin-43) is a 43 kDa transmembrane protein that forms gap junctions—intercellular channels facilitating direct exchange of ions, metabolites, and signaling molecules between adjacent cells . In Xenopus laevis, GJA1 is expressed in multiciliated epithelial cells and localizes to ciliary axonemes, pericentriolar regions, and gap junctions . Its recombinant form retains structural and functional properties, making it vital for studying ciliogenesis, cardiac development, and cell coordination .

Production and Purification

Recombinant Xenopus GJA1 is produced in E. coli or HEK293 systems, tagged with His or Myc for purification . Key specifications include:

Table 3: Key Interactions

Interacting ProteinRole in GJA1 FunctionMethod of Detection
Rab11Ciliary vesicle trafficking Co-IP, SIM imaging
BBS4Basal body organization Immunofluorescence
CP110Centriole capping regulation CRISPR/Cas9 mutants

Research Applications

  • ELISA/Western Blot: Detects GJA1 in Xenopus tissue lysates .

  • Cilia Studies: Used to dissect Rab11-dependent trafficking in multiciliated epithelia .

  • Disease Modeling: Links to oculodentodigital dysplasia and arrhythmogenic cardiomyopathy .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery details.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a final concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference point.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type preference, please inform us. We will prioritize developing the specified tag according to your request.
Synonyms
gja1; Gap junction alpha-1 protein; Connexin-43; Cx43
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-379
Protein Length
Full Length of Mature Protein
Species
Xenopus laevis (African clawed frog)
Target Names
Target Protein Sequence
GDWSALGRLLDKVQAYSTAGGKVWLSVLFIFRILLLGTAVESAWGDEQSAFVCNTQQPGC ENVCYDKSFPISHVRFWVLQIIFVSTPTLLYLAHVFYLMRKEEKLNRKEEELKMVQNEGG NVDMHLKQIEIKKFKYGLEEHGKVKMRGGLLRTYIISILFKSVFEVGFIIIQWYMYGFSL SAIYTCKRDPCPHQVDCFLSRPTEKTIFIWFMLIVSIVSLALNIIELFYVTYKSIKDGIK GKKDPFSATNDAVISGKECGSPKYAYFNGCSSPTAPMSPPGYKLVTGERNPSSCRNYNKQ ASEQNWANYSAEQNRMGQAGSTISNTHAQPFDFSDEHQNTKKMAPGHEMQPLTILDQRPS SRASSHASSRPRPDDLEI
Uniprot No.

Target Background

Function
A gap junction is comprised of a cluster of closely packed pairs of transmembrane channels, known as connexons. These channels facilitate the diffusion of low molecular weight materials between adjacent cells. Gap junction alpha-1 protein (gja1) plays a critical role in gap junction communication within the ventricles.
Database Links

KEGG: xla:373664

UniGene: Xl.1109

Protein Families
Connexin family, Alpha-type (group II) subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, gap junction.
Tissue Specificity
Expressed in most tissues. Highest levels found in eye and brain.

Q&A

What is the structure and function of Xenopus laevis GJA1?

Gap junction alpha-1 protein (GJA1/Cx43) is a major component of gap junction complexes that function as transport channels across cell membranes. The protein consists of four transmembrane domains (TM1-4), interdomain loops between each TM domain, and intracellular N- and C-terminus domains . The full-length protein spans amino acids 2-379 and contains several functional domains, including a unique tubulin-binding sequence (amino acids 234-243) in the C-terminus that is not conserved in other gap junction protein families .

While traditionally known for forming intercellular channels that allow direct communication between adjacent cells, recent research has revealed that GJA1 has a previously unappreciated role in ciliogenesis - the formation of cellular cilia . This dual functionality makes GJA1 a multifaceted protein with significant implications for both cell communication and ciliary development.

Where is GJA1 localized within cells?

GJA1 exhibits surprising complexity in its subcellular localization pattern, extending well beyond its canonical presence at gap junctions. In Xenopus multiciliated cells, GJA1 is found at:

  • Cell-cell junctions as gap junction complexes

  • Near the apical surface as puncta

  • In ciliary axonemes

  • Below or above the basal bodies (but not overlapping with centrin, a basal body marker)

In mouse branchial epithelium, endogenous GJA1 localizes to ciliary axonemes as puncta . Interestingly, in human RPE1 cells (with primary cilia), GJA1:

  • Localizes to gap junctions on the cell periphery

  • Accumulates in pericentriolar regions where primary cilia originate

  • Is broadly distributed in the Golgi and pericentriolar regions

  • Does not appear to localize directly to the primary cilium itself

These diverse localization patterns suggest that GJA1 performs distinct functions depending on its subcellular context and the type of cilium present in the cell.

What functional domains exist in GJA1 and how do they contribute to its activity?

GJA1 contains several key functional domains that contribute to its diverse cellular roles:

  • Transmembrane domains (TM1-4): Four membrane-spanning domains that anchor the protein in the cell membrane and form the channel structure.

  • Interdomain loops: Connect the transmembrane domains and contribute to channel function.

  • Intracellular N- and C-terminus domains: Mediate protein-protein interactions and regulatory functions.

  • Tubulin-binding sequence (amino acids 234-243): A 10-amino acid sequence in the C-terminus that is unique to GJA1 and not conserved in other gap junction protein families .

The functional significance of these domains has been demonstrated through mutational studies. Three dominant-negative mutants have revealed critical insights:

  • T154A point mutation: Mimics the closed-channel status of the gap junction complex but does not inhibit gap junction formation

  • Δ130-136 deletion: A seven-amino acid deletion in the intracellular loop between TM2 and TM3 that blocks gap junction permeability

  • Δ234-243 deletion: Removes the tubulin-binding sequence in the C-terminus

All three dominant-negative mutants caused severe defects in cilia formation when expressed in Xenopus embryos, with particularly notable decreases in ciliary number in the Δ234-243 mutant . This suggests that multiple functional domains of GJA1 contribute to its role in ciliogenesis, beyond merely forming gap junctions.

What model systems are appropriate for studying GJA1 function in ciliogenesis?

Multiple experimental systems have proven effective for studying GJA1's role in ciliogenesis, each with distinct advantages:

Xenopus laevis embryos: These provide readily accessible multiciliated cells in the embryonic epidermis that are amenable to microinjection techniques. This system allows for visual assessment of motile cilia and multiciliated cells using established markers . Importantly, Xenopus embryos also enable the study of both motile multicilia and nodal cilia involved in left-right asymmetry.

Xenopus gastrocoel roof plate (GRP): This specialized structure possesses nodal cilia crucial for left-right axis determination. The impact of GJA1 manipulation can be assessed through observable phenotypes like heart looping and PITX2 expression . GJA1 morphants displayed abnormally shortened nodal cilia in the GRP and approximately 30% developed situs inversus (reversed organs), demonstrating GJA1's importance in this process .

Human RPE1 cells: This human cell line readily forms primary cilia upon serum starvation and is compatible with siRNA transfection, plasmid expression, and high-resolution imaging techniques. RPE1 cells are particularly useful for studying GJA1's role in primary cilia formation and pericentriolar organization .

For comprehensive insights, a combination of these systems provides the strongest approach, allowing cross-validation of findings across species and cell types.

What controls are essential when investigating GJA1 function?

Based on the experimental approaches described in the research, several critical controls are necessary when investigating GJA1 function in cilia formation:

For morpholino knockdown experiments in Xenopus:

  • Control morpholino (non-targeting sequence)

  • Rescue with morpholino-resistant GJA1 mRNA to confirm specificity

For CRISPR/Cas9 mutagenesis:

  • Cas9 without guide RNA or with non-targeting guide RNA

  • Sequencing confirmation of target site editing to verify mutation efficiency

For siRNA experiments in cell culture:

  • Non-targeting siRNA control

  • Rescue experiments with siRNA-resistant GJA1 expression plasmid

For cell fate determination studies:

  • Analysis of multiciliated cell specification markers like DNAH9 to distinguish between effects on cell fate versus ciliogenesis

  • This is crucial as GJA1 morphants showed normal numbers of DNAH9-positive multiciliated cells despite reduced acetylated tubulin staining, indicating that GJA1 affects ciliogenesis rather than cell fate determination

For protein localization and interaction studies:

  • Appropriate antibody controls (isotype controls for immunoprecipitation)

  • Multiple cellular markers to precisely identify subcellular compartments

These controls ensure that observed phenotypes can be specifically attributed to GJA1 manipulation rather than off-target effects or general developmental disruptions.

How should recombinant Xenopus laevis GJA1 be stored and handled?

For optimal experimental results, recombinant Xenopus laevis GJA1 protein requires specific storage and handling conditions:

Storage conditions:

  • Store at -20°C for regular storage

  • For extended storage, conserve at -20°C or -80°C

  • Working aliquots can be stored at 4°C for up to one week

  • Repeated freezing and thawing is not recommended

Buffer composition:

  • The protein is supplied in a Tris-based buffer with 50% glycerol, optimized for stability

Handling recommendations:

  • Upon receipt, it's advisable to create multiple small working aliquots to minimize freeze-thaw cycles

  • When designing experiments, consider the buffer composition which may affect certain assay conditions

  • The high glycerol content (50%) helps maintain protein stability but should be accounted for when calculating final concentrations in reaction mixtures

The commercial product is available in a quantity of 50 μg, with other quantities also available. The recombinant protein is derived from Xenopus laevis (African clawed frog) and corresponds to UniProt accession P16863 .

What methods effectively visualize GJA1 localization in ciliated cells?

Several complementary methods have proven effective for visualizing GJA1 localization in ciliated cells:

Immunofluorescence staining: This approach uses antibodies against GJA1 or epitope tags (Flag, HA) for recombinant GJA1. Co-staining with ciliary markers like acetylated tubulin (for ciliary axonemes), basal body markers like centrin (for centrioles/basal bodies), Golgi markers (TGN46), or pericentriolar material markers (BBS4) helps establish precise subcellular localization .

Expression of tagged GJA1 constructs: Microinjection of mRNA encoding GJA1-Flag or GJA1-HA into Xenopus embryos or transfection of tagged constructs into cultured cells allows visualization of the protein in live or fixed specimens . This approach revealed that GJA1-Flag strongly accumulated at cell-cell junctions but also localized near the apical surface as puncta and in ciliary axonemes in Xenopus multiciliated cells .

Advanced microscopy techniques: Structured illumination microscopy (SIM) provides higher resolution imaging critical for visualizing fine structures. This technique was particularly valuable for observing Rab11-positive vesicles encircling the base of ciliary axonemes and their altered distribution following GJA1 depletion .

Tissue-specific analysis: Preparation of specialized tissue explants, such as GRP tissue for imaging nodal cilia, enables visualization of GJA1 in specific developmental contexts .

For most robust results, combining multiple approaches is recommended to confirm localization patterns across different experimental conditions and model systems.

What loss-of-function approaches are effective for studying GJA1?

Multiple effective approaches have been established for inhibiting GJA1 function in various model systems:

Morpholino-mediated knockdown in Xenopus:

  • Antisense morpholino oligonucleotides targeting GJA1 mRNA can be microinjected into specific blastomeres at early developmental stages

  • For targeting multiciliated cells: inject into ventral-animal regions of two-cell stage embryos

  • For targeting GRP tissues: inject into dorsal-vegetal cells in four-cell stage embryos

CRISPR/Cas9-mediated mutagenesis in Xenopus:

  • The research utilized guide RNA targeting GJA1 (5'-GTCTGCAATACTCAGCAACCagg-3')

  • Cas9 protein with guide RNA (RNP) complex was microinjected (20 fmol) into the ventral-animal region of blastomeres at the two-cell stage

  • Editing efficiency was confirmed by genomic DNA extraction from stage 28 embryos, PCR amplification of the target region, and in vitro Cas9 digestion or sequencing analysis

siRNA-mediated knockdown in human cell lines:

  • siRNA transfection effectively depleted GJA1 in human RPE1 cells

  • Knockdown was confirmed by immunoblotting

  • Specificity was demonstrated through rescue experiments using siRNA-non-targetable GJA1 constructs

Dominant-negative mutant expression:

  • Three effective dominant-negative GJA1 constructs were employed:

    • T154A point mutation (mimics closed-channel status)

    • Δ130–136 deletion (blocks gap junction permeability)

    • Δ234–243 deletion (removes tubulin-binding sequence)

  • These constructs were microinjected as mRNA into Xenopus embryos

Each approach offers distinct advantages: morpholinos provide transient knockdown, CRISPR/Cas9 enables permanent genetic disruption, and dominant-negative constructs can target specific protein functions while preserving others.

How can protein-protein interactions of GJA1 be effectively studied?

Several complementary techniques have successfully revealed GJA1's protein interaction network:

Co-immunoprecipitation (Co-IP): This approach confirmed interactions between GJA1 and Rab proteins (Rab8a, Rab11a). The methodology involved cell lysis under conditions that preserve protein-protein interactions, immunoprecipitation using antibodies against GJA1 or epitope tags, and western blot analysis to detect co-precipitated proteins . Importantly, this technique revealed that all dominant-negative GJA1 mutants (T154A, Δ130–136, Δ234–243) failed to interact with Rab11a, providing functional validation of domain requirements for these interactions .

Immunoprecipitation followed by mass spectrometry (IP-MS): This unbiased approach identified novel GJA1 interacting partners, including Rab8a and Rab11a . The technique is particularly valuable for discovering previously unknown interactions.

Co-localization analysis: Immunofluorescence microscopy visualized spatial relationships between GJA1 and interaction partners. GJA1 and Rab11 were shown to partially co-localize around the pericentriolar region, with GJA1 surrounding the Rab11 cluster that accumulated around basal bodies . Enhanced resolution through structured illumination microscopy (SIM) revealed Rab11-positive vesicles encircling the base of ciliary axonemes .

Functional validation: Expression of dominant-negative GJA1 mutants and analysis of their effects on potential interacting partners provides functional evidence for the biological significance of identified interactions .

Protein level analysis after depletion: Western blotting showed decreased Rab8a and Rab11 protein levels in GJA1-depleted cells, suggesting GJA1 may stabilize these proteins or regulate their expression .

For comprehensive characterization of GJA1 interactions, combining biochemical, microscopy-based, and functional approaches provides the strongest evidence.

How should cilia defects resulting from GJA1 depletion be quantified?

Comprehensive quantification of ciliary defects following GJA1 manipulation requires multiple complementary parameters:

Ciliated cell quantification:

  • Immunostaining for acetylated tubulin to visualize ciliated cells

  • Counting the number of acetylated tubulin-positive cells in control versus GJA1-depleted samples

  • Expressing results as a percentage of total cells or as an absolute number per field of view

  • The research demonstrated a significant reduction in acetylated tubulin-positive multiciliated cells in both GJA1 morphants and CRISPR/Cas9-targeted embryos

Cilia length measurement:

  • Isolating cilia from control and experimental embryos

  • Measuring individual cilium length using microscopy and image analysis

  • Calculating average length and distribution

  • Ciliary length was significantly shorter in dominant-negative GJA1-expressing embryos compared to controls

Cilia density analysis:

  • Counting the number of cilia emanating from individual multiciliated cells

  • This parameter was notably decreased in Δ234–243 mutant-injected embryos

Basal body assessment:

  • Immunostaining for basal body markers like centrin

  • Evaluating the number and apical localization of basal bodies

  • In GJA1-depleted embryos, basal body number and localization remained comparable to controls, indicating the defect is specific to cilia formation rather than basal body development

Functional readouts:

  • For nodal cilia: quantifying the percentage of embryos with situs inversus (reversed organ positioning)

  • Approximately 30% of GJA1 morphant embryos developed situs inversus, demonstrating disrupted nodal ciliary function

For statistical validity, these measurements should be performed on multiple biological replicates and analyzed using appropriate statistical tests.

How can GJA1's role in gap junctions be distinguished from its role in ciliogenesis?

Distinguishing between GJA1's canonical gap junction functions and its newly discovered role in ciliogenesis requires strategic experimental approaches:

Domain-specific mutant analysis:
Research employed three dominant-negative GJA1 mutants affecting different functional aspects:

  • T154A point mutation: Mimics closed-channel status but doesn't inhibit gap junction formation

  • Δ130–136 deletion: Blocks gap junction permeability

  • Δ234–243 deletion: Removes the tubulin-binding sequence unique to GJA1

All three mutants caused cilia formation defects, with the Δ234–243 deletion (affecting the tubulin-binding domain) showing particularly severe effects on ciliary numbers . This suggests that GJA1's interaction with the cytoskeleton is critical for its ciliogenesis function.

Subcellular localization analysis:

  • Gap junction function correlates with GJA1 localization at cell-cell contacts

  • Ciliogenesis role associates with GJA1 in:

    • Ciliary axonemes (Xenopus multiciliated cells)

    • Pericentriolar regions (human RPE1 cells)

    • Below or above basal bodies

Protein interaction studies:

  • GJA1 immunoprecipitates with ciliary trafficking proteins Rab8a and Rab11a

  • All dominant-negative GJA1 mutants failed to interact with Rab11a

  • This suggests that GJA1's role in ciliogenesis involves interactions with vesicle trafficking machinery

Cell type comparisons:
Studying GJA1 across diverse ciliary contexts reveals consistent requirements for ciliogenesis:

  • Multiciliated cells with motile cilia (Xenopus epidermal cells)

  • Monociliated cells with primary cilia (RPE1 cells)

  • Nodal cilia (Xenopus GRP)

This approach helps differentiate between gap junction functions and fundamental roles in different ciliary types.

What molecular mechanisms underlie GJA1's effect on ciliogenesis?

Research has revealed several interconnected molecular mechanisms through which GJA1 influences ciliogenesis:

Regulation of Rab11-Rab8 ciliary trafficking:
GJA1 physically interacts with both Rab11a and Rab8a, key regulators of vesicle trafficking during ciliogenesis . GJA1 depletion causes:

  • Decreased Rab8a and Rab11 protein levels

  • Loss of Rab11 accumulation at the base of the primary cilium

  • Scattered rather than organized Rab11 signals

This indicates GJA1 regulates ciliogenesis by facilitating proper localization and potentially stabilizing components of the Rab11-Rab8 ciliary trafficking pathway.

Impact on CP110 removal:
CP110 is a centriolar protein whose removal from the mother centriole is essential for cilia initiation. GJA1 depletion significantly reduced CP110 removal from the mother centriole . This disruption of a critical early step in ciliogenesis likely contributes to the observed ciliary defects.

Effects on pericentriolar organization:
GJA1 depletion affects the organization of the pericentriolar region, with notably reduced acetylated microtubules . This perturbation of the pericentriolar environment likely impairs the recruitment and organization of ciliary components.

Ciliary axoneme formation:
While basal body number and localization remained normal in GJA1-depleted cells, ciliary axoneme formation was severely impaired . This suggests GJA1 functions primarily in the extension of the cilium rather than in basal body formation or positioning.

Together, these findings suggest GJA1 acts as a multifunctional regulator of ciliogenesis, influencing both the early steps of cilia initiation (CP110 removal) and the trafficking machinery (Rab11-Rab8) required for ciliary membrane extension.

How does GJA1 regulate the Rab11-Rab8 ciliary trafficking pathway?

The research provides substantial evidence for GJA1's role in regulating the Rab11-Rab8 ciliary trafficking pathway, a critical process in ciliogenesis:

Biochemical interaction:

  • GJA1 physically interacts with both Rab8a and Rab11a as demonstrated by co-immunoprecipitation experiments

  • These interactions were initially identified through immunoprecipitation followed by mass spectrometry (IP-MS)

Spatial relationship:

  • GJA1 and Rab11 partially co-localize around the pericentriolar region

  • GJA1 surrounds the Rab11 cluster that accumulates around basal bodies

  • High-resolution structured illumination microscopy (SIM) revealed that Rab11-positive vesicles encircle the base of the ciliary axoneme in normal cells

Functional impact of GJA1 depletion:

  • Decreased Rab8a and Rab11 protein levels

  • Loss of Rab11 accumulation at the base of primary cilia

  • Scattered rather than organized Rab11 signals

Domain requirements:

  • All three dominant-negative GJA1 mutants (T154A, Δ130–136, Δ234–243) failed to interact with Rab11a

  • This suggests multiple domains of GJA1 are required for proper interaction with Rab11

The Rab11-Rab8 pathway is essential for ciliary vesicle trafficking—Rab11 controls transport of vesicles to the basal body, while Rab8 (activated by Rab11) promotes vesicle fusion and ciliary membrane extension. GJA1 appears to function as a scaffold or regulator for this pathway, ensuring proper localization of Rab proteins during ciliogenesis and potentially stabilizing them.

This mechanism explains how a gap junction protein can influence cilia formation through effects on vesicular trafficking rather than direct channel function.

What is GJA1's role in left-right asymmetry determination?

GJA1 plays a crucial role in establishing left-right asymmetry during embryonic development through its effects on nodal cilia:

Function in gastrocoel roof plate (GRP):
In Xenopus, the gastrocoel roof plate (GRP) possesses nodal cilia that generate leftward flow necessary for left-right asymmetry. GJA1 is required for proper formation of these nodal cilia .

Experimental evidence:
When GJA1 morpholino was injected into the two dorsal-vegetal cells in four-cell stage embryos (targeting GRP tissues), GJA1 morphants displayed abnormally shortened nodal cilia in the GRP compared to control embryos .

Consequences for left-right asymmetry:

  • Heart development:

    • Approximately 30% of GJA1 morphant embryos developed situs inversus (reversed organs)

    • This was visualized in the ventral view of embryonic hearts where the truncus arteriosus is normally placed to the left

  • Molecular signaling:

    • Expression of the left lateral plate mesoderm (LPM)-specific marker PITX2 was abnormal in GJA1-morphant embryos

    • PITX2 is a key transcription factor in the left-right asymmetry cascade normally expressed only on the left side in response to nodal flow

The pathway connecting GJA1 to left-right asymmetry appears to follow this sequence:

  • GJA1 is required for proper nodal cilia formation in the GRP

  • Defective nodal cilia fail to generate proper leftward flow

  • Disrupted flow affects left-specific gene expression (e.g., PITX2)

  • Abnormal gene expression leads to randomized organ placement

This finding extends GJA1's significance beyond cellular-level processes to whole-organism developmental patterning, highlighting how molecular defects in cilia formation can manifest as macroscopic developmental abnormalities.

What are the implications of GJA1's dual localization and function?

The discovery of GJA1's presence in both gap junctions and ciliary structures represents a paradigm shift in understanding connexin biology with several important implications:

Redefinition of connexin function:
GJA1 is not merely a structural component of gap junctions but has broader cellular roles. Its localization to ciliary structures suggests functions in ciliogenesis independent of intercellular communication . This challenges the traditional view of connexins as solely gap junction proteins.

Cell type-specific adaptations:
GJA1 shows context-dependent localization—in multiciliated cells, it localizes to ciliary axonemes, while in cells with primary cilia, it accumulates in pericentriolar regions . This suggests evolutionary adaptation of GJA1 functions to cell-specific requirements.

Signaling integration:

  • Gap junctions facilitate direct communication between adjacent cells

  • Cilia function as cellular antennae for extracellular signals

  • GJA1's presence in both structures suggests it could coordinate intercellular and extracellular signaling pathways

Disease relevance:
Mutations in GJA1 are associated with oculodentodigital dysplasia (ODDD). The newly discovered role in ciliogenesis suggests that some disease manifestations might relate to ciliary defects rather than gap junction dysfunction. This could explain clinical features not easily attributable to gap junction defects.

Evolutionary conservation:
The dual role of GJA1 appears conserved across species (observed in Xenopus, mouse, and human cells) . This conservation underscores its fundamental importance in vertebrate development and physiology.

Therapeutic implications:
Understanding GJA1's distinct functions in different locations could enable more targeted therapeutic approaches. Domain-specific interventions might selectively affect ciliary functions without disrupting gap junctions, or vice versa.

This dual functionality of GJA1 exemplifies how proteins can evolve multiple roles and operate in distinct cellular contexts, expanding our understanding of protein multifunctionality beyond canonical classifications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.