Recombinant Xenopus laevis Gap junction beta-1 protein (gjb1)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Xenopus laevis Gap Junction Beta-1 Protein (GJB1)

Recombinant Xenopus laevis GJB1 is a synthetic variant of the gap junction protein beta-1 (connexin32), engineered for research applications. This protein is produced through recombinant DNA technology, often expressed in bacterial systems like Escherichia coli and purified with affinity tags (e.g., His-tag) for structural and functional studies . GJB1 belongs to the connexin family, forming intercellular channels that enable ion and small molecule exchange between adjacent cells .

Expression and Purification

  • Host System: Expressed in E. coli for high-yield production .

  • Purification: Utilizes nickel-nitrilotriacetic acid (Ni-NTA) columns to isolate His-tagged GJB1 .

  • Storage: Lyophilized powder stored at -20°C/-80°C to prevent degradation .

Research Applications

  1. Structural Studies:

    • Analyzed via SDS-PAGE to confirm monomeric (~32 kDa) and multimeric forms .

    • Used in X-ray crystallography or cryo-EM to resolve connexon assembly .

  2. Functional Assays:

    • Studied in calcium signaling pathways (e.g., cardiac cell regulation) .

    • Tested for channel gating properties using voltage-clamp electrophysiology .

  3. Disease Modeling:

    • Mutant GJB1 variants (e.g., F31S, W44G) induce intracellular aggregation and stress granules, mimicking Charcot-Marie-Tooth disease (CMTX1) pathology .

Key Pathways

GJB1 participates in:

PathwayRelated Proteins
Calcium Regulation in Cardiac CellsGJC2, GJB5, CX27.5, ANXA6
Gap Junction TraffickingVesicle transport machinery

Protein Interactions

  • Homodimerization: Forms connexons via interactions between six GJB1 subunits .

  • Heterotypic Channels: Couples with other connexins (e.g., Cx26) to regulate ion selectivity .

Key Insights

  1. Aggregation and Toxicity:

    • Mutant GJB1 variants (e.g., R220Pfs*23) exhibit SDS-resistant multimers and reduced cell viability in HeLa cells .

    • Truncated mutants accumulate in stress granules (G3BP1-positive), impairing cellular function .

  2. Prenylation Dependency:

    • Wild-type GJB1 is prenylated, enabling proper membrane localization . Mutations disrupting this process (e.g., C280G) block channel formation .

Unresolved Questions

  • Species-Specific Roles: Limited data exist on Xenopus GJB1’s physiological role compared to human and rodent models.

  • Therapeutic Targets: Whether recombinant GJB1 can rescue mutant phenotypes in vivo remains unexplored.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks if needed. We will accommodate your request whenever possible.
Lead Time
Delivery times vary depending on purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag will be determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
gjb1; Gap junction beta-1 protein; Connexin-30; Cx30
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-264
Protein Length
full length protein
Species
Xenopus laevis (African clawed frog)
Target Names
gjb1
Target Protein Sequence
MNWAGLYAILSGVNRHSTSIGRIWLSVVFIFRIMVLVAAAESVWGDEKSAFTCNTQQPGC NSVCYDHFFPISHIRLWALQLIIVSTPALLVAMHVAHLQHQEKKELRLSRHVKDQELAEV KKHKVKISGTLWWTYISSVFFRIIFEAAFMYIFYLIYPGYSMIRLLKCDAYPCPNTVDCF VSRPTEKTIFTVFMLVASGVCIVLNVAEVFFLIAQACTRRARRHRDSGSISKEHQQNEMN LLITGGSIIKRSAGQEKGDHCSTS
Uniprot No.

Target Background

Function

Gap junctions are formed by clusters of closely packed connexon pairs, transmembrane channels facilitating the diffusion of low-molecular-weight materials between adjacent cells.

Database Links

KEGG: xla:394373

UniGene: Xl.1191

Protein Families
Connexin family, Beta-type (group I) subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, gap junction.
Tissue Specificity
Lung, liver, intestines, stomach and kidney.

Q&A

What is the normal function of GJB1 in Xenopus laevis compared to mammalian models?

GJB1 (Gap Junction Beta-1) in Xenopus laevis, like its mammalian counterpart, encodes the connexin-32 protein that forms intercellular channels called gap junctions. These channels facilitate the transport of nutrients, ions, and small signaling molecules between adjacent cells. In the nervous system, connexin-32 is localized in specialized cells including Schwann cells and oligodendrocytes, which are involved in myelin production and maintenance .

The evolutionary position of Xenopus laevis between aquatic vertebrates and land tetrapods makes it particularly valuable for comparative studies of connexin function. The fundamental similarity of Xenopus laevis's cellular communication systems to mammalian systems, combined with the evolutionary distance, allows researchers to distinguish conserved features from species-specific adaptations .

How does the structure of recombinant Xenopus laevis GJB1 differ from human GJB1?

Xenopus laevis GJB1 shares significant structural homology with human GJB1, particularly in the transmembrane domains and extracellular loops that are critical for channel formation. Key structural elements include:

DomainHuman GJB1Xenopus GJB1Functional Significance
Transmembrane domains4 domains (TM1-4)4 conserved domainsChannel formation and membrane integration
N-terminal domainCytoplasmicCytoplasmicVoltage gating
Extracellular loops2 loops with conserved cysteine residues2 loops with conserved cysteinesDocking between adjacent cells
C-terminal domainVariable regionMore divergent from humanRegulatory functions and protein interactions

Notable differences occur primarily in the C-terminal domain, which is typically more variable across species and may contribute to species-specific regulatory mechanisms. The F31 and W44 residues located in the first transmembrane domain appear to be functionally important across species, as mutations in these positions can lead to protein aggregation and cellular stress .

What developmental stages of Xenopus laevis show the highest gjb1 expression?

GJB1 expression in Xenopus laevis follows a developmentally regulated pattern. While the search results don't provide specific expression data across developmental stages, researchers can refer to the comprehensive developmental resource available on Xenbase, which includes illustrations and marker gene expression data from fertilization to metamorphosis .

For precise developmental expression patterns, researchers should consult the Landmarks Table (https://www.xenbase.org/entry/landmarks-table.do), which documents key morphological features and marker gene expression that can distinguish stages . This resource is particularly valuable for determining optimal collection times for tissues expressing GJB1 during developmental studies.

What are the most effective methods for expressing recombinant Xenopus laevis GJB1 protein in vitro?

For efficient in vitro expression of recombinant Xenopus laevis GJB1, researchers should consider the following methodological approach:

  • Vector selection: Construct expression vectors containing the GJB1 coding sequence with appropriate epitope tags (such as FLAG) for detection and purification. The pcDNA3.1 vector has been successfully used for GJB1 expression .

  • Cell line selection: HeLa cells have been effectively used for GJB1 expression studies and allow for analysis of intracellular trafficking and gap junction formation. For higher protein yields, consider HEK293 cells or insect cell expression systems.

  • Transfection optimization:

    • Lipid-based transfection reagents typically provide good efficiency for mammalian expression

    • Optimize DNA:transfection reagent ratios (typically starting with 1:3)

    • Monitor expression at multiple time points (24-72 hours post-transfection) to determine optimal harvest time

  • Protein detection: Use both anti-GJB1 (Cx32) antibodies and antibodies against the epitope tag for comprehensive detection. This dual approach allows differentiation between endogenous and recombinant protein .

  • Extraction considerations: Due to its multiple transmembrane domains, GJB1 requires careful extraction conditions. Sequential extraction with increasing detergent strengths can help distinguish properly folded protein from aggregates .

How can researchers differentiate between monomeric and multimeric forms of recombinant GJB1 in biochemical assays?

Differentiating between monomeric and multimeric forms of recombinant GJB1 requires specific biochemical approaches:

  • SDS-PAGE analysis: Under standard conditions with reducing agents, GJB1 typically resolves as a 32-kDa band (full-length) and sometimes a lower 28-kDa band. Multimeric forms appear as higher molecular weight bands above 50 kDa. For optimal separation, use 10-12% gels .

  • Sequential fractionation protocol:

    • Solubilize cells in a series of buffers with increasing detergent strength

    • Begin with Triton X-100 to isolate properly folded membrane proteins

    • Progress to SDS-containing buffers to solubilize aggregated proteins

    • Final extraction with SDS plus reducing agents for completely insoluble aggregates

  • Blue native PAGE: For preserving native protein complexes, use non-denaturing blue native PAGE, which maintains quaternary structure.

  • Cross-linking studies: Chemical cross-linking prior to SDS-PAGE can stabilize transient interactions between GJB1 monomers and help visualize natural multimeric assemblies.

  • Microscopy correlation: Correlate biochemical findings with immunofluorescence microscopy to distinguish between monomers in the endoplasmic reticulum, hexameric connexons in transit, and complete gap junction plaques at the cell surface .

What quality control measures should be implemented when purifying recombinant Xenopus laevis GJB1?

To ensure high-quality purification of recombinant Xenopus laevis GJB1:

  • Functional verification: Assess gap junction functionality through dye transfer assays between adjacent cells expressing the recombinant protein.

  • Structural integrity checks:

    • Circular dichroism to verify proper secondary structure

    • Protease protection assays to confirm correct membrane topology

    • Glycosylation analysis to verify proper post-translational modifications

  • Aggregate detection methods:

    • Size exclusion chromatography to separate monomeric, oligomeric, and aggregated species

    • Dynamic light scattering to assess size distribution and potential aggregation

    • Monitoring the ratio between 32-kDa band and lower bands on immunoblots

  • Subcellular localization: Confirm proper trafficking using organelle markers for the endoplasmic reticulum and Golgi apparatus through immunofluorescence microscopy .

  • Batch consistency monitoring: Implement regular quality control testing between batches, using the CCK-8 cell viability assay to ensure that purified protein maintains consistent biological effects .

How can recombinant Xenopus laevis GJB1 be used to study Charcot-Marie-Tooth disease mechanisms?

Recombinant Xenopus laevis GJB1 offers valuable insights into Charcot-Marie-Tooth disease mechanisms through several experimental approaches:

  • Comparative mutation analysis:

    • Generate equivalent disease-causing mutations identified in human patients (like F31S, W44G, and R220Pfs*23) in Xenopus GJB1

    • Compare trafficking, aggregation propensity, and functional impact between species to identify conserved pathological mechanisms

    • Use these comparisons to distinguish fundamental disease mechanisms from species-specific effects

  • Protein aggregation studies:

    • Investigate how disease-causing mutations affect protein folding and aggregation

    • Assess the formation of detergent-resistant species through sequential fractionation

    • Compare wild-type and mutant protein behavior in terms of SDS-soluble multimers and monomers

  • Cellular stress response evaluation:

    • Monitor stress granule formation using markers like G3BP1

    • Quantify the percentage of cells showing stress responses when expressing mutant versus wild-type GJB1

    • Correlate stress granule formation with cell viability measures

  • Gap junction functionality assessment:

    • Examine the impact of mutations on gap junction plaque formation

    • Determine which mutations primarily affect trafficking versus channel function

    • Correlate structural defects with functional outcomes and disease severity

What insights into protein aggregation mechanisms have been gained from studies of GJB1 mutations?

Research on GJB1 mutations has provided critical insights into protein aggregation mechanisms:

  • Mutation-specific aggregation patterns:

    • Transmembrane domain mutations (F31S, W44G) show distinct aggregation profiles compared to C-terminal mutations (R220Pfs*23)

    • All mutants demonstrate higher expression and greater aggregation propensity than wild-type GJB1

    • The frameshift mutation R220Pfs*23 produces the greatest amount of SDS-soluble multimers and monomers among studied variants

  • Cellular compartmentalization of aggregates:

    • Aggregation primarily occurs in the endoplasmic reticulum rather than the Golgi apparatus

    • This suggests that quality control mechanisms in the ER fail to prevent accumulation of misfolded GJB1

  • Downstream cellular consequences:

    • GJB1 aggregates trigger formation of stress granules, with mutant forms inducing significantly more stress granules than wild-type protein

    • Approximately 24% of cells expressing wild-type GJB1 form stress granules, compared to 40-48% in cells expressing mutant variants

    • Cell viability is significantly reduced in cells expressing the R220Pfs*23 mutant, demonstrating direct cytotoxicity of protein aggregates

How do mutations in TM domains versus C-terminal domains of GJB1 differ in their cellular effects?

Mutations in different domains of GJB1 produce distinct cellular phenotypes:

DomainRepresentative MutationsPrimary Cellular EffectsGap Junction FormationStress ResponseCell Viability Impact
TM1 domainF31S, W44GEnhanced protein aggregation, primarily as lower molecular weight bands (~28 kDa)Partially compromisedSignificant increase in stress granule formation (40-48% of cells)Mild reduction in cell viability
C-terminal domainR220Pfs*23Truncated protein with altered size, highest levels of SDS-soluble multimersSeverely compromisedSignificant increase in stress granule formation (40-48% of cells)Severe reduction in cell viability (p<0.001 compared to wild-type)

The differential effects suggest domain-specific mechanisms:

  • TM domain mutations likely disrupt proper membrane insertion and folding of GJB1

  • C-terminal truncation may interfere with regulatory interactions and proper trafficking

  • All mutations trigger cellular stress responses, but C-terminal truncation appears most detrimental to cell survival

How can inter-species differences in GJB1 be leveraged to understand evolutionary conservation of gap junction function?

The evolutionary position of Xenopus laevis between aquatic vertebrates and land tetrapods makes it an excellent model for studying the evolution of gap junction proteins. Researchers can leverage inter-species differences through:

  • Phylogenetic analysis: Construct comprehensive phylogenetic trees of GJB1 across vertebrate species to identify conserved domains and species-specific adaptations.

  • Domain swapping experiments:

    • Create chimeric proteins combining domains from Xenopus and mammalian GJB1

    • Assess functionality of these chimeras in gap junction formation

    • Determine which domains confer species-specific properties

  • Functional conservation testing:

    • Express Xenopus GJB1 in mammalian cells and vice versa

    • Assess cross-species compatibility in gap junction formation

    • Identify conserved functional residues through site-directed mutagenesis

  • Developmental context analysis:

    • Compare GJB1 expression patterns during development across species

    • Correlate with the acquisition of species-specific traits, particularly in nervous system myelination

    • Utilize the comprehensive developmental resources available for Xenopus to establish precise temporal expression patterns

What are the methodological challenges in distinguishing GJB1 trafficking defects from functional defects in connexin channels?

Distinguishing between trafficking and functional defects in GJB1 presents several methodological challenges:

  • Combined defect confounding:

    • Proteins with trafficking defects may never reach the plasma membrane, making it difficult to assess their intrinsic channel function

    • Partial trafficking may result in reduced function that appears similar to channel dysfunction

  • Methodological approaches to separate defects:

    • Subcellular fractionation: Isolate plasma membrane fractions to quantify the proportion of GJB1 reaching the cell surface

    • Surface biotinylation assays: Specifically label and quantify surface-exposed GJB1

    • Temperature-sensitive trafficking rescue: Incubate cells at reduced temperatures (e.g., 30°C) to potentially rescue trafficking defects for certain mutations

    • Inducible expression systems: Use temporal control of expression to distinguish acute functional effects from long-term trafficking consequences

  • Functional assessment of successfully trafficked channels:

    • Electrophysiological recording: Directly measure gap junction conductance

    • Dye transfer assays: Quantify intercellular transfer of gap junction-permeable dyes

    • Metabolic coupling assays: Assess transfer of specific metabolites between coupled cells

  • Imaging approaches:

    • FRAP (Fluorescence Recovery After Photobleaching): Measure dynamic exchange between gap junction plaques and assess mobile fractions

    • Super-resolution microscopy: Distinguish between hemichannels and complete gap junctions at the plasma membrane

How do post-translational modifications of GJB1 differ between Xenopus laevis and mammalian systems?

While the search results don't provide specific information on post-translational modifications (PTMs) of Xenopus laevis GJB1, this represents an important area for future research. Researchers should consider:

  • Comparative PTM mapping:

    • Use mass spectrometry to identify and compare phosphorylation, ubiquitination, SUMOylation, and other modifications

    • Create a comprehensive PTM map comparing Xenopus and mammalian GJB1

  • Regulatory enzyme conservation:

    • Identify kinases, phosphatases, and other modifying enzymes that act on GJB1

    • Assess conservation of these regulatory pathways between species

  • Functional impact assessment:

    • Generate phosphomimetic and phosphodeficient mutations at conserved sites

    • Compare their effects on trafficking, aggregation, and channel function

    • Determine if species-specific PTMs confer unique regulatory properties

  • Environmental and developmental regulation:

    • Investigate how PTMs change during development or in response to environmental stressors

    • Compare these responses between Xenopus and mammalian systems to identify conserved stress-response mechanisms

What are the optimal conditions for assessing gap junction formation and function in cells expressing recombinant Xenopus laevis GJB1?

For optimal assessment of gap junction formation and function with recombinant Xenopus laevis GJB1:

  • Cell system selection:

    • HeLa cells provide a good model as they have minimal endogenous connexin expression

    • For more physiologically relevant studies, consider Schwann cell or oligodendrocyte cultures that naturally express GJB1

  • Expression optimization:

    • Use inducible expression systems to control protein levels

    • Aim for expression levels that minimize aggregation while providing sufficient protein for detection

    • Monitor expression at 24-48 hours post-transfection for optimal gap junction formation

  • Imaging parameters:

    • Use confocal microscopy to clearly distinguish between intracellular GJB1 and membrane plaques

    • Co-stain with plasma membrane markers and organelle markers to determine localization

    • Image live cells to capture dynamic aspects of gap junction formation and remodeling

  • Functional assessments:

    • Dye transfer assay protocol:

      • Load donor cells with a gap junction-permeable dye (e.g., Lucifer Yellow)

      • Monitor transfer to adjacent recipient cells over time

      • Quantify dye spread rate and distance to assess channel functionality

    • Dual patch-clamp protocol:

      • Form gigaohm seals on adjacent coupled cells

      • Measure junctional conductance in response to transjunctional voltage steps

      • Determine voltage-gating properties specific to GJB1 channels

How can researchers effectively troubleshoot protein aggregation issues when working with recombinant GJB1?

When encountering protein aggregation issues with recombinant GJB1:

  • Expression system modifications:

    • Reduce expression levels by using weaker promoters or reducing DNA amount in transfections

    • Try different cell types that may provide better chaperone support

    • Consider lower temperature incubation (30-32°C) to slow protein synthesis and allow proper folding

  • Buffer and lysis optimization:

    • Implement sequential extraction with increasing detergent strengths to characterize aggregation states

    • Test different detergents: CHAPS may be gentler than SDS for membrane protein extraction

    • Add stabilizing agents like glycerol (10-15%) to buffers

  • Co-expression strategies:

    • Co-express molecular chaperones to assist proper folding

    • Try fusion tags known to enhance solubility (e.g., SUMO, MBP, or GST)

    • Use split GFP systems to monitor properly folded fractions

  • Analytical troubleshooting approaches:

    • Perform immunofluorescence to determine subcellular localization of aggregates

    • Use G3BP1 staining to assess whether aggregates induce stress granule formation

    • Compare wild-type and known aggregation-prone mutants (F31S, W44G) as controls

  • Quantitative assessment:

    • Use the CCK-8 cell viability assay to determine the cytotoxicity of aggregates

    • Quantify the percentage of cells showing stress granules as a measure of cellular stress

    • Implement image analysis to quantify aggregate size and distribution

What experimental controls should be included when studying disease-causing mutations in recombinant Xenopus laevis GJB1?

A comprehensive set of experimental controls is essential when studying disease-causing mutations:

  • Expression controls:

    • Empty vector transfection to establish baseline cellular conditions

    • Wild-type GJB1 expression to compare against mutants

    • Multiple independent clones of each construct to rule out clone-specific artifacts

    • Standardized expression level monitoring across experiments

  • Mutation-specific controls:

    • Include both previously characterized mutations (e.g., R220Pfs*23, Y157H) and novel mutations (e.g., F31S, W44G)

    • Test conservative amino acid substitutions at mutation sites to distinguish specific effects from general disruption

    • Include mutations from different protein domains to identify domain-specific patterns

  • Functional validation controls:

    • Positive controls for gap junction formation (e.g., wild-type connexin-43)

    • Negative controls for protein aggregation (e.g., soluble cytosolic proteins)

    • Positive controls for stress granule induction (e.g., sodium arsenite treatment)

  • Technical controls:

    • Use multiple detection methods (e.g., FLAG tag and connexin-specific antibodies)

    • Implement multiple time points to distinguish transient from persistent effects

    • Include both biochemical (e.g., immunoblotting) and cell biological (e.g., immunofluorescence) techniques to corroborate findings

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.