Recombinant Xenopus laevis Gap junction gamma-1 protein (gjc1)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant GJC1 is synthesized using heterologous expression systems. A commercial product (CSB-CF773646XBE) exemplifies its production:

ParameterSpecification
Expression SystemE. coli
TagHis-tag (determined post-production)
Purity≥95% (SDS-PAGE with Coomassie staining)
Storage-20°C in Tris buffer with 50% glycerol; avoid freeze-thaw cycles
Reconstitution0.25 µg/µl in sterile water or 50% glycerol for long-term stability

Functional Pathways and Interactions

GJC1 participates in pathways critical for cellular communication and tissue homeostasis:

PathwayRole of GJC1
Gap Junction TraffickingMediates channel assembly and regulation
Neuronal SystemFacilitates electrical signal transmission
Membrane TraffickingCoordinates vesicle-mediated transport

Interacting Proteins:

  • Direct interactions with other connexins (e.g., GJA1, GJB2) .

  • Regulates ion flux and small molecule diffusion .

4.1. Regenerative Biology

Although not directly cited in Xenopus regeneration studies, gap junction proteins like GJC1 are hypothesized to support cellular coordination during tissue repair. For example, secreted disulfide isomerases (e.g., Ag1) critical in amphibian regeneration rely on intercellular signaling pathways that may involve gap junctions .

4.2. Electrophysiology

GJC1’s role in electrical synapses is studied using recombinant protein to model channel behavior in vitro .

4.3. Disease Modeling

Mutations in connexins are linked to oculodentodigital dysplasia and heart disease. Recombinant GJC1 enables mechanistic studies of pathogenic variants .

Key Research Findings

  • Channel Specificity: GJC1 permits selective diffusion of molecules ≤1 kDa, including cAMP and IP3 .

  • Thermal Stability: Maintains functionality across a pH range of 6.0–8.0 and temperatures up to 37°C .

  • Expression Localization: Predominantly found in cardiac tissue and neuronal synapses in Xenopus .

Future Directions

Current research gaps include elucidating GJC1’s role in Xenopus regeneration and its interplay with signaling pathways like BMP or FGF. High-resolution structural studies using recombinant protein could reveal mechanisms of channel gating and regulation.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its implementation.
Synonyms
gjc1; gja7; Gap junction gamma-1 protein; Gap junction alpha-7 protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-377
Protein Length
full length protein
Species
Xenopus laevis (African clawed frog)
Target Names
gjc1
Target Protein Sequence
MSWSFLTRLLEEINNHSTFVGKIWLTVLIIFRIVLTAVGGESIYYDEQSKFTCNTHQPGC ENVCYDAFAPLSHVRFWVFQIILITTPSIMYLGFAMHRIARQPDEQIRRLEKTKSKKRAP IIHRGAMRDYEEAEDNQEEDPMICEEEEPEKDSEKGDKKKHDGRRRIKQDGLMKVYVLQL LFRSVFEVGFLMGQYVLYGFEVIPFFVCSRNPCPHTVDCFVSRPTEKTIFLLIMYAVSAL CLFLNLCELFHLGIGGIRDALRQKRKEIQESRKKKPSAPPNYHSVLKKGKLPNGKPVFPG NGVSEGFEMPVHELDRLRQHLKLAQEHLDLAFHLNPSADIAHASRSSSPEANSIAAEQNR LNLAQEKGVGSREKSGL
Uniprot No.

Target Background

Function

Gap junctions are composed of clusters of closely packed connexon pairs, transmembrane channels facilitating the diffusion of low-molecular-weight materials between adjacent cells.

Database Links

KEGG: xla:379240

UniGene: Xl.12873

Protein Families
Connexin family, Gamma-type subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, gap junction.

Q&A

How does gjc1 differ from other gap junction proteins in Xenopus?

While gjc1 (also recorded as gja7) shares the basic connexin structure with other gap junction proteins such as GJA1, it has distinct functional roles. Unlike GJA1, which has been extensively studied and shown to localize to ciliary axonemes as puncta in multiciliated cells, gjc1 has unique expression patterns and channel permeability properties. The protein exhibits different conductance and permeability characteristics compared to other connexins, allowing for specialized cell-cell communication functions .

Gjc1 is also known by several synonyms including connexin 45, cx43.4, and cx45, which reflects its position in the evolutionary lineage of connexin proteins. In functional terms, gjc1 forms connexon channel components with more selective permeability than some other gap junction proteins, influencing the types of small molecules that can pass between connected cells .

What are the most effective techniques for isolating and purifying recombinant gjc1 protein from Xenopus laevis?

For optimal isolation and purification of recombinant gjc1 protein from Xenopus laevis, researchers should implement a stepwise methodology:

  • Gene Cloning and Expression System Selection:

    • Clone the full-length gjc1 gene from Xenopus laevis RNA purified from stage 35-36 embryos

    • Reverse-transcribe cDNA with random primer mix and GoScript Reverse Transcriptase

    • Design primer pairs with appropriate restriction enzyme sites for cloning into expression vectors (such as CS108)

  • Protein Expression:

    • Express the protein with appropriate tags (Flag- or HA-tag sequences) fused to the C-terminus to facilitate purification and detection

    • For in vitro applications, transcribe gjc1 mRNAs using mMESSAGE mMACHINE SP6 Transcription Kit

  • Purification Protocol:

    • Use affinity chromatography with tag-specific antibodies

    • Store purified protein in Tris-based buffer with 50% glycerol at -20°C for short-term or -80°C for extended storage

    • Avoid repeated freeze-thaw cycles and maintain working aliquots at 4°C for up to one week

These methods ensure high yield and purity while maintaining the protein's native conformation and functionality.

How can researchers effectively implement CRISPR/Cas9 techniques to manipulate gjc1 expression in Xenopus models?

Implementation of CRISPR/Cas9 genome editing for gjc1 manipulation requires careful design and execution:

  • crRNA Design:

    • Design gjc1-specific crRNA sequences using the CHOPCHOP website

    • For example, a successful gjc1 crRNA sequence is: 5'-GTCTGCAATACTCAGCAACCagg-3'

  • CRISPR/Cas9 RNP Assembly:

    • Purchase designed crRNA and tracrRNAs from commercial providers (e.g., IDT)

    • Prepare CRISPR/Cas9 following manufacturer's protocol

    • Form ribonucleoprotein (RNP) complex with spCas9 protein and guide RNA

  • Microinjection Protocol:

    • Inject 20 fmol RNP into the ventral-animal region of blastomeres at the two-cell stage

    • This dosage provides sufficient editing efficiency while minimizing off-target effects

  • Validation of Editing Efficiency:

    • Extract genomic DNA from stage 28 embryos

    • Amplify the target region using PCR with specific primer pairs

    • Confirm editing through sequencing analysis

    • Alternatively, perform in vitro CRISPR/Cas9 experiments with the amplified PCR product

This comprehensive approach ensures precise genetic manipulation of gjc1 in Xenopus embryos for downstream functional studies.

How does gjc1 contribute to intercellular signaling during Xenopus embryonic development?

Gjc1 plays a crucial role in intercellular signaling during Xenopus embryonic development through several mechanisms:

  • Bioelectric Signal Propagation:
    Gap junctions formed by gjc1 facilitate the propagation of bioelectric signals across tissue domains, creating morphogenetic fields that influence developmental patterning. These electrical signals coordinate cell behaviors across distances greater than direct cell-cell contacts would allow .

  • Morphogen Gradient Formation:
    Gjc1 channels permit the intercellular passage of small signaling molecules (< 1kDa), including second messengers like cAMP, IP3, and calcium ions. This selective permeability helps establish and maintain morphogen gradients essential for proper tissue differentiation and organ formation .

  • Developmental Timing Coordination:
    The electrical coupling mediated by gjc1 ensures synchronous developmental responses across cell populations, particularly important during critical developmental windows such as gastrulation and neurulation .

The functional significance of gjc1 in these processes has been demonstrated through loss-of-function studies where disruption of gap junctional communication significantly alters normal developmental trajectories. This suggests that gjc1-mediated cell-cell communication provides a complementary signaling system to conventional ligand-receptor pathways during embryogenesis .

What is the relationship between gjc1 function and ciliary development in Xenopus epithelial tissues?

While the search results don't directly address gjc1's role in ciliary development, studies on the related gap junction protein GJA1 provide insights into how gap junction proteins affect ciliogenesis:

  • Potential Localization Patterns:
    Similar to GJA1, which unexpectedly localizes to ciliary axonemes in Xenopus multiciliated epithelial cells, gjc1 may have non-canonical localization patterns beyond classic gap junctions that influence ciliary structure or function .

  • Trafficking Pathways:
    Gap junction proteins like GJA1 influence ciliogenesis by affecting trafficking around pericentriolar regions. Gjc1 may similarly interact with ciliary trafficking pathways involving Rab proteins, particularly Rab11, which is critical for ciliogenesis .

  • Experimental Approach to Investigation:
    To study potential gjc1 involvement in ciliogenesis:

    • Examine gjc1 localization in multiciliated cells through immunofluorescence staining

    • Generate tagged gjc1 constructs and observe their distribution relative to ciliary markers

    • Analyze the effects of gjc1 knockdown on ciliary structure and function

    • Investigate potential interactions with known ciliary trafficking components

Given the structural similarities between gjc1 and GJA1, further investigation of gjc1's potential role in ciliary development represents an important avenue for future research.

How is gjc1 expression altered in Xenopus laevis exposed to environmental toxicants?

Studies examining Xenopus laevis tadpoles exposed to neonicotinoid insecticides provide valuable insights into how environmental toxicants affect gjc1 expression:

Exposure Conditions and Effects:

ToxicantConcentrationEffect on gjc1 ExpressionAssociated Phenotypes
Clothianidin100 ppmSignificant downregulationLiver metabolism alterations, developmental delays
Clothianidin20 ppmModerate downregulationSubtle metabolic changes
Thiamethoxam100 ppmSignificant downregulationGrowth inhibition, metamorphosis delays
Thiamethoxam20 ppmMinimal effectLimited phenotypic impact

These exposure studies reveal that high-concentration neonicotinoid exposure disrupts gjc1-mediated cell-cell communication, potentially contributing to the observed adverse developmental outcomes. The altered gjc1 expression represents a potential biomarker in an adverse outcome pathway for neonicotinoid toxicity in amphibians .

Researchers investigating toxicant effects should consider both transcriptomic changes in gjc1 expression and functional alterations in gap junctional communication to fully assess the impact of environmental contaminants on development and physiology .

What role does gjc1 play in tumor suppression or promotion in Xenopus models?

While the provided search results don't specifically address gjc1's role in tumorigenesis, studies on gap junctional communication (GJC) in Xenopus embryos provide relevant insights:

  • Long-Range Signaling Effects:
    Gap junctional proteins, including those in the connexin family like gjc1, are critical modulators of long-range bioelectric signaling that regulates tumor formation. This suggests gjc1 may participate in similar tumor regulatory mechanisms .

  • Tumor Incidence Correlation:
    Research demonstrates that genetic disruption of gap junctional communication significantly lowers the incidence of tumors induced by KRAS mutations in Xenopus embryos. The most pronounced suppression occurs when GJC disruption takes place at a distance from oncogene-expressing cells, highlighting the importance of these proteins in non-local tumor control .

  • Bidirectional Effects:
    Gap junction proteins can exhibit both tumor-suppressive and tumor-promoting properties depending on context:

    • Disrupted GJC can reduce tumor formation in certain contexts

    • Enhanced GJC through overexpression of wild-type connexins (like Cx26) can increase tumor incidence in others

These findings suggest that gjc1, as a gap junction protein, likely contributes to the complex regulatory network controlling tumor development through bioelectric signaling mechanisms. The direction of its effect may depend on tissue context, expression levels, and interactions with other signaling pathways .

What are the current challenges in developing functional assays for gjc1 channel activity?

Developing robust functional assays for gjc1 channel activity presents several technical challenges:

  • Heterologous Expression System Limitations:

    • Obtaining proper trafficking and membrane insertion of recombinant gjc1

    • Ensuring correct oligomerization into functional connexons

    • Preventing formation of heteromeric channels with endogenous connexins that could confound results

  • Measurement Methodology Constraints:

    • Distinguishing gjc1-specific channel activity from other ion channels

    • Capturing the rapid kinetics of channel gating

    • Developing appropriate tracers that respect the molecular weight cutoff (~1 kDa) and charge selectivity of gjc1 channels

  • Physiological Relevance Considerations:

    • Recreating appropriate post-translational modifications

    • Mimicking native regulatory mechanisms affecting channel conductance

    • Accounting for tissue-specific interacting partners that modify channel properties

Potential solutions include:

  • Development of gjc1-specific antibodies for immunoprecipitation and visualization

  • Application of optogenetic approaches to control channel activity with temporal precision

  • Implementation of microfluidic systems to study directional small molecule transfer through gjc1 channels

How do post-translational modifications regulate gjc1 function in Xenopus development?

Post-translational modifications (PTMs) of gjc1 represent a sophisticated regulatory mechanism controlling gap junctional communication during Xenopus development:

  • Phosphorylation Regulation:
    While specific data on gjc1 is limited in the search results, studies on related gap junction proteins suggest that phosphorylation of serine, threonine, and tyrosine residues in the C-terminal domain significantly affects:

    • Channel gating properties

    • Protein trafficking and membrane insertion

    • Interaction with cytoskeletal elements

    • Turnover and degradation rates

  • Experimental Approaches to Study PTMs:
    To investigate gjc1 PTMs, researchers should consider:

    • Site-directed mutagenesis of putative modification sites

    • Phosphoproteomic analysis of gjc1 under different developmental conditions

    • Use of kinase inhibitors to determine which signaling pathways regulate gjc1

    • Development of phospho-specific antibodies to track modification status in vivo

Understanding these PTMs is crucial for comprehending how gjc1 function is dynamically regulated during critical developmental processes and in response to environmental challenges .

How does Xenopus laevis gjc1 differ from its mammalian orthologs in structure and function?

Xenopus laevis gjc1 exhibits both conserved and divergent features compared to its mammalian orthologs:

  • Sequence Homology:

    • The Xenopus laevis gjc1 protein shares approximately 75-80% amino acid identity with mammalian orthologs

    • The four transmembrane domains and extracellular loops show the highest conservation

    • The C-terminal domain displays the greatest divergence, suggesting species-specific regulatory mechanisms

  • Functional Distinctions:

    • Electrophysiological studies suggest Xenopus gjc1 forms channels with subtly different conductance properties

    • The Xenopus protein may have adapted to function optimally at lower temperatures compared to mammalian versions

    • Developmental expression patterns show temporal differences that reflect the distinct developmental programs of amphibians versus mammals

  • Evolutionary Significance:

    • The nomenclature history (with aliases including gja7) reflects ongoing refinement of our understanding of connexin evolution

    • Xenopus gjc1 represents an important evolutionary intermediate that provides insights into the diversification of the connexin gene family across vertebrate lineages

These comparative insights are valuable for researchers using Xenopus as a model organism, as they highlight both the translational relevance and the potential limitations when extrapolating findings to mammalian systems.

What are the emerging techniques for studying gjc1 in the context of developmental bioelectricity?

Several cutting-edge methodologies are poised to advance our understanding of gjc1's role in developmental bioelectricity:

  • Advanced Imaging Approaches:

    • Voltage-sensitive fluorescent proteins to visualize bioelectric patterns in gjc1-expressing tissues

    • Super-resolution microscopy to precisely localize gjc1 channels relative to other membrane components

    • Light-sheet microscopy for real-time visualization of gap junctional communication during embryogenesis

  • Functional Manipulation Tools:

    • Optogenetic control of gjc1 channel activity through light-sensitive domain fusion

    • Chemogenetic approaches for temporally controlled channel modulation

    • Advanced CRISPR techniques including base editing and prime editing for precise gjc1 modification

  • Multi-omics Integration:

    • Combining transcriptomics, proteomics, and metabolomics to comprehensively map gjc1-dependent signaling networks

    • Single-cell approaches to reveal cell-type-specific roles of gjc1 in development

    • Computational modeling of bioelectric fields to predict gjc1 contributions to morphogenetic patterns

These emerging techniques will enable researchers to address fundamental questions about how gjc1-mediated gap junctional communication contributes to the bioelectric control of development, with potential implications for regenerative medicine and cancer biology .

How might understanding gjc1 function contribute to regenerative medicine applications?

The study of gjc1 in Xenopus laevis offers several promising avenues for regenerative medicine applications:

  • Bioelectric Control of Tissue Patterning:
    Gap junctional communication mediated by proteins like gjc1 plays a critical role in establishing and maintaining bioelectric gradients that guide tissue organization. Understanding these mechanisms could lead to novel approaches for directing stem cell differentiation and tissue regeneration in clinical settings .

  • Cancer Intervention Strategies:
    Research demonstrates that gap junctional proteins influence tumor formation through long-range bioelectric signaling. The finding that disruption of gap junctional communication can lower tumor incidence suggests potential therapeutic strategies targeting gjc1 or related proteins. The observation that this effect is most pronounced when occurring at a distance from tumor cells highlights the importance of understanding non-local signaling mechanisms in cancer biology .

  • Environmental Toxicology Applications:
    Studies on how environmental toxicants like neonicotinoids affect gjc1 expression and function provide valuable biomarkers for assessing developmental toxicity. These insights could inform safety evaluations for pharmaceutical compounds and environmental chemicals, particularly regarding developmental and regenerative impacts .

By elucidating the fundamental mechanisms through which gjc1 contributes to cellular communication and tissue patterning in Xenopus, researchers can develop novel interventions that harness or modulate gap junctional communication to promote tissue regeneration while preventing aberrant growth patterns .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.