Recombinant Xenopus laevis GDP-Man:Man (3)GlcNAc (2)-PP-Dol alpha-1,2-mannosyltransferase (alg11)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a particular tag, please specify it in your order; we will prioritize fulfilling your request.
Synonyms
alg11; GDP-Man:Man(3GlcNAc(2-PP-Dol alpha-1,2-mannosyltransferase; Asparagine-linked glycosylation protein 11 homolog; Glycolipid 2-alpha-mannosyltransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-486
Protein Length
full length protein
Species
Xenopus laevis (African clawed frog)
Target Names
Target Protein Sequence
MAGPMCLCGMMRLLTALFIPVLITSVGLCLIFVLLFICTRLWVQRKKKVEIGKDGKKKKV VAFFHPYCNAGGGGERVLWCALRSLQKRYKDAIYVIYTGDKDASEEQILNGAAARFNIKL SHPVRFIFLEKRGLVEASCYPRFTLLGQSLGSVVLGWEALTKCVPDIYIDSMGYAFTLPL FKYLGGCHVGCYVHYPTISMDMLSVVRSQHARFNNAAFISNNPVLSRLKLIYYYLFALFY GWVGSCSDVIMVNSTWTFSHILDLWKCSDRTSIVYPPCDVQTFLEIDINQHKENEEHSVV SIGQFRPEKDHPLQIRAFAALLEKKTAEQRAKLKLILIGGCRNDEDELRVSELKKLSSEL GIPVEFKVNVPFEELKKHLSEATIGLHTMWNEHFGIGIVECMAAGTIILAHNSGGPKLDI VVPHEEQQTGFLADSVDSYAAAMDHILSLTPEQRLSIRQNARLSVGRFSDQEFEANFLAS SEPLFK
Uniprot No.

Target Background

Database Links

KEGG: xla:733388

UniGene: Xl.53984

Protein Families
Glycosyltransferase group 1 family, Glycosyltransferase 4 subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

Q1: What is the primary biochemical function of Xenopus laevis ALG11?

Answer:
Recombinant Xenopus ALG11 catalyzes the α-1,2-mannosylation of Man₃GlcNAc₂-PP-dolichol and Man₄GlcNAc₂-PP-dolichol, extending the lipid-linked oligosaccharide (LLO) precursor to Man₅GlcNAc₂-PP-dolichol . This reaction is critical for N-glycosylation, as defects in ALG11 homologs (e.g., human ALG1) cause congenital disorders of glycosylation (CDG) .

Methodological Insight:
To study its activity, researchers often use:

  • Enzyme assays with radiolabeled GDP-mannose and Man₃GlcNAc₂-PP-dolichol substrates.

  • In vitro reconstitution of glycosylation reactions using purified ALG11 and ER membrane fractions .

Q2: How does Xenopus ALG11 differ from mammalian and yeast ALG1 homologs?

Answer:
While Xenopus ALG11 shares conserved catalytic motifs with human ALG1 and yeast Alg11, sequence divergence may influence substrate specificity or regulatory interactions. For example:

FeatureXenopus ALG11Human ALG1Yeast Alg11
SubstrateMan₃GlcNAc₂-PP-DolMan₃GlcNAc₂-PP-DolMan₃GlcNAc₂-PP-Dol
Reactionα-1,2-mannosylationα-1,4-mannosylationα-1,2-mannosylation
Disease AssociationNot reportedCDG-IkAlg1-deficient phenotypes

Methodological Insight:
Compare substrate affinities using kinetic assays (e.g., Michaelis-Menten) or homology modeling to predict structural differences .

Q3: What experimental approaches validate ALG11 knockouts or overexpression in Xenopus models?

Answer:

  • CRISPR-Cas9 gene editing: Generate ALG11 knockouts and assess glycosylation defects via:

    • Mass spectrometry of serum transferrin or immunoglobulins to detect truncated N-glycans .

    • Metabolic labeling with [³H]glucosamine to track LLO intermediates .

  • Overexpression studies: Use transgenic Xenopus lines to monitor:

    • ER stress markers (e.g., CHOP, BiP) as ALG11 dysfunction disrupts glycosylation .

    • Protein secretion efficiency via pulse-chase assays.

Q4: How can ALG11 activity be quantified in Xenopus cell lysates or recombinant preparations?

Answer:

MethodProtocol StepsControls/Challenges
Radiometric Assay1. Incubate ALG11 with [¹⁴C]GDP-Man and Man₃GlcNAc₂-PP-Dol.
2. Separate products via TLC.
Requires authentic substrates; quantify via phosphorimaging .
ELISA1. Use anti-ALG11 antibodies to detect enzyme activity.
2. Validate with positive/negative controls.
Limited by antibody specificity; cross-reactivity with homologs .
LC-MS/MS1. Analyze reaction products (e.g., Man₅GlcNAc₂-PP-Dol).
2. Normalize against internal standards.
High cost; requires expertise in lipidomics .

Optimization Tip:
Test pH (6.5–8.0), temperature (20–37°C), and divalent cations (Mg²⁺ vs. Mn²⁺) to maximize activity .

Q5: What mutagenesis strategies can identify critical residues in Xenopus ALG11?

Answer:

  • Site-directed mutagenesis: Target conserved residues (e.g., His, Asp) in catalytic motifs.

  • Error-prone PCR: Generate random variants and screen for loss/gain of function.

  • Homology-guided mutagenesis: Compare Xenopus ALG11 to human ALG1 (e.g., p.R438W in ALG1 ) and introduce analogous mutations.

Data Analysis:

  • Enzymatic activity assays: Compare WT vs. mutant ALG11 using kinetic parameters (Kₘ, Vₘₐₓ) .

  • Structural modeling: Use PyMOL or FoldX to predict ΔΔG of mutations .

Q6: How to resolve conflicting data on ALG11’s role in glycosylation vs. other pathways?

Answer:

  • Cross-system validation: Compare findings in Xenopus with human/yeast models. For example:

    • Yeast Alg11 regulates ER-to-Golgi trafficking .

    • Human ALG1 defects cause CDG-Ik with hydrops fetalis .

  • Multi-omics integration: Combine proteomics (glycoprotein profiles) and transcriptomics (ER stress markers) to contextualize ALG11’s function.

  • Inhibitor studies: Use GDP-Man analogs to selectively block ALG11 activity and isolate its contributions .

Q7: Why might ALG11 recombinant protein show low activity in vitro?

Answer:

CauseMitigation Strategy
Incorrect foldingInclude chaperones (e.g., GroEL/GroES) during E. coli expression .
OxidationAdd reducing agents (e.g., DTT) to storage buffer .
Substrate qualityPurify Man₃GlcNAc₂-PP-Dol from endogenous lipids using silica chromatography .

Diagnostic Tools:

  • Circular dichroism (CD): Assess secondary structure integrity.

  • Western blot: Confirm protein expression and His-tag presence .

Q8: How to address batch-to-batch variability in recombinant ALG11 preparations?

Answer:

  • Standardize purification: Optimize Ni-NTA chromatography conditions (e.g., imidazole gradient) .

  • Activity normalization: Quantify ALG11 concentration via Bradford assay and adjust reaction volumes.

  • Controlled storage: Freeze aliquots at -80°C with stabilizing agents (e.g., 15% glycerol) .

Q9: Can ALG11 be engineered for synthetic glycosylation pathways?

Answer:
Yes. Chimeric ALG11 constructs could redirect substrate specificity. For example:

  • Domain swapping: Replace the dolichol-binding domain with lipid anchors from other glycosyltransferases.

  • Co-factor engineering: Modify GDP-Man binding sites to accept alternative nucleotide sugars (e.g., GDP-Fuc).

Validation Approach:
Test engineered ALG11 in in vitro glycosylation systems with fluorescently labeled acceptors .

Q10: How to model ALG11 dysfunction in Xenopus embryos for disease studies?

Answer:

  • Microinjection of morpholinos: Knock down ALG11 mRNA in early embryos.

  • CRISPR-Cas9 targeting: Generate germline mutants for heritable defects.

  • Phenotypic analysis: Monitor developmental arrest, hydrops, or neurological defects .

Key Markers:

  • Glycoprotein hypoglycosylation (e.g., transferrin isoforms via lectin blotting) .

  • ER stress activation (e.g., BiP upregulation via qPCR) .

Q11: What statistical methods are suitable for analyzing ALG11 activity data?

Answer:

Data TypeAnalysis MethodSoftware Tools
Kinetic parametersNonlinear regression (Michaelis-Menten)GraphPad Prism, R (nls)
Mutant vs. WTTwo-way ANOVA with Tukey’s post-hoc testSPSS, Python (SciPy)
Pathway integrationNetwork analysis (Cytoscape)Cytoscape, STRING

Best Practices:

  • Replicates: Include ≥3 biological replicates to account for batch effects.

  • Normalization: Use internal controls (e.g., β-actin for qPCR) .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.