Recombinant Xenopus laevis Glutamate receptor, ionotropic kainate 2 (grik2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
grik2; glur6; Glutamate receptor ionotropic, kainate 2; GluK2; Glutamate receptor 6; GluR-6; GluR6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-285
Protein Length
full length protein
Species
Xenopus laevis (African clawed frog)
Target Names
Target Protein Sequence
SELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYG AVQDGATMTFFKKSRIPTYEKMWAFMNSRSQSVLVKNNEEGIQRALTSDYAFLMESTTIE FVTQRNCNLTQIGGLIDSKGYGVGTPMGSPYRDKITIAILQLQEEGVLHMMKEKWWRGNG CPEEESKEASALGVQNIGGIFIVLAAGLVLSVFVAVGEFLYKSKKNAQLEKRSFCSAMVE ELRMSLKCQRRLKHKPQPPVIVKTEEVINMHTFNDRRLPGKETMA
Uniprot No.

Target Background

Function

Recombinant Xenopus laevis Glutamate Receptor, Ionotropic Kainate 2 (GRIK2)

GRIK2 is an ionotropic glutamate receptor. L-glutamate, acting as an excitatory neurotransmitter at numerous central nervous system synapses, binds to the receptor. This binding induces a conformational change, opening a cation channel and converting the chemical signal into an electrical impulse. The receptor rapidly desensitizes, entering a transient inactive state with bound agonist. Independently of its ionotropic glutamate receptor activity, GRIK2 functions as a thermoreceptor, conferring cold temperature sensitivity in dorsal root ganglion neurons.

Database Links

UniGene: Xl.21633

Protein Families
Glutamate-gated ion channel (TC 1.A.10.1) family, GRIK2 subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, synapse, postsynaptic cell membrane; Multi-pass membrane protein.

Q&A

What is GRIK2 and what is its function in Xenopus laevis?

GRIK2 (also known as GluK2) in Xenopus laevis functions as an ionotropic glutamate receptor that forms a cation-permeable ligand-gated ion channel. When L-glutamate or kainic acid binds to this receptor, it induces a conformational change that opens the cation channel, effectively converting chemical signals to electrical impulses in neurons . Following activation, the receptor rapidly desensitizes and enters a transient inactive state characterized by the presence of bound agonist . In Xenopus development, GRIK2 plays crucial roles in neurotransmission and potentially in early nervous system development, similar to its role in mammals. The receptor contributes to excitatory neurotransmission at many synapses throughout the central nervous system and may modulate cell surface expression of other proteins like NETO2 .

Why is Xenopus laevis an ideal model for studying GRIK2 function?

Xenopus laevis offers multiple advantages for studying GRIK2 function. Most significantly, Xenopus oocytes provide an excellent expression system for recombinant receptors, as demonstrated in studies where oocytes injected with rat brain mRNA expressed functional glutamate and kainate receptors . The large size of these oocytes facilitates electrophysiological recordings and protein expression studies. Additionally, Xenopus embryos are large, transparent, and have abundant cytoplasm, making them ideal for developmental studies . The species can breed year-round, unlike seasonal amphibians, providing consistent access to research materials . Importantly, Xenopus has approximately 90% homology with human disease genes, including those in glutamate signaling pathways, making findings potentially translatable to human health research . The external fertilization and development of Xenopus embryos also facilitate experimental manipulations and observations throughout development .

How does Xenopus GRIK2 compare to human GRIK2?

Xenopus GRIK2 shares significant structural and functional homology with human GRIK2, reflecting the evolutionary conservation of glutamate receptors across vertebrate species. Both function as glutamate-gated cation channels with similar pharmacological properties. The value of studying Xenopus GRIK2 for human health research is underscored by studies showing that mutations in human GRIK2 cause neurodevelopmental disorders with intellectual disability and developmental delay as core features . Recent research has identified specific mutations in human GRIK2 (p.Thr660Lys, p.Thr660Arg, and p.Ala657Thr) that are associated with neurodevelopmental deficits . These mutations, when introduced into recombinant GluK2 subunits, produce complex effects on receptor function and membrane localization that can be studied in expression systems like Xenopus oocytes . The strong conservation of these functionally important residues between species makes Xenopus an appropriate model for investigating how these mutations affect receptor function.

What developmental stages are optimal for GRIK2 studies in Xenopus?

While the search results don't provide specific staging information for GRIK2 expression in Xenopus, the developmental trajectory of this model organism is well-characterized, with 66 defined stages from fertilization through metamorphosis . For GRIK2 studies, key developmental periods would include neurulation (when the first neurons are specified), early tadpole stages (when neural circuits begin to form), and metamorphosis (when significant nervous system remodeling occurs). The ability to follow development through these stages in transparent embryos makes Xenopus particularly valuable for studying how GRIK2 expression and function change during development. Additionally, the regenerative capacity of Xenopus tadpoles in tissues including spinal cord, lens, tail, and limbs provides opportunities to study GRIK2's potential role in neural regeneration . For precise experimental design, researchers should map GRIK2 expression across developmental stages using techniques like in situ hybridization or developmental RT-PCR.

What are the optimal methods for recombinant expression of GRIK2 in Xenopus oocytes?

For optimal recombinant expression of GRIK2 in Xenopus oocytes, researchers should implement a systematic approach beginning with proper mRNA preparation. The GRIK2 cDNA should be cloned into a vector containing appropriate 5' and 3' untranslated regions from Xenopus genes to enhance translation efficiency. Following in vitro transcription to generate capped mRNA with a poly(A) tail, the mRNA should be purified using standard methods. For oocyte preparation, harvest stage V-VI oocytes from anesthetized adult female Xenopus laevis and treat them with collagenase to remove follicular cells . Inject 50-100 ng of GRIK2 mRNA per oocyte using a microinjector with consistent pressure and timing parameters. Maintain injected oocytes in OR2 medium supplemented with antibiotics at 18°C for 2-4 days to allow for protein expression . This approach has been successful for expressing various glutamate receptors, as demonstrated in studies where oocytes injected with rat brain mRNA expressed functional glutamate and kainate receptors that could be characterized electrophysiologically .

How should electrophysiological recordings be set up to accurately measure GRIK2 channel activity?

For accurate electrophysiological recordings of GRIK2 channel activity in Xenopus oocytes, a two-electrode voltage clamp (TEVC) setup should be employed with glass microelectrodes filled with 3M KCl (resistances between 0.5-3 MΩ). The membrane potential should typically be clamped at -60 to -80 mV for standard recordings, with a stable baseline current established before agonist application. Based on previous studies, the standard bath solution should contain approximately 96 mM NaCl, 2 mM KCl, 1.8 mM CaCl₂, 1 mM MgCl₂, and 5 mM HEPES (pH 7.4) . For receptor activation, apply glutamate (0.1-1 mM) or kainate (0.01-0.1 mM) using a fast perfusion system, allowing sufficient time between applications (2-3 minutes) for receptor recovery from desensitization . Data should be sampled at ≥2 kHz and filtered at 0.5-1 kHz to capture both onset and desensitization kinetics. For current-voltage relationship studies, perform voltage ramps or steps before, during, and after agonist application. The reversal potential for GRIK2 is typically near 0 mV, distinct from the chloride-dependent reversal potential of approximately -24 mV seen with some other receptors .

What controls are essential when studying recombinant GRIK2?

When studying recombinant GRIK2 in Xenopus systems, several essential controls must be implemented to ensure experimental validity. Negative controls should include water-injected oocytes to control for endogenous receptor responses and injection procedures, uninjected oocytes to establish baseline electrical properties, and application of bath solution without agonist to control for mechanical artifacts during perfusion . Positive controls should include both glutamate and kainate application to confirm functional expression, as these agonists produce characteristic responses in GRIK2-expressing oocytes . When studying GRIK2 mutations, wild-type receptors must be examined in parallel under identical conditions. This approach is exemplified in studies of human GRIK2 variants (p.Ala657Thr, p.Thr660Lys, and p.Thr660Arg), where comparison with wild-type receptors revealed altered gating kinetics in the mutant channels . Additionally, pharmacological controls using specific GRIK2 antagonists and modulators help confirm receptor identity and pharmacology. Expression controls via Western blotting, immunofluorescence, or GFP tagging can verify receptor protein expression and membrane localization.

How can CRISPR-Cas9 be used to modify GRIK2 in Xenopus?

Implementing CRISPR-Cas9 genome editing to modify GRIK2 in Xenopus requires a carefully designed methodology. Begin by designing 2-3 guide RNAs targeting exonic regions of GRIK2, preferably early exons, using Xenopus-specific genome databases to ensure target specificity. For microinjection, prepare a mixture of Cas9 protein (or mRNA) and gRNA, then inject 2-4 cell stage embryos in one or two blastomeres depending on desired targeting (unilateral vs. bilateral). A typical injection might contain 500 pg Cas9 protein with 300 pg gRNA per embryo. For mutation detection, extract DNA from individual embryos or tissue samples at desired stages, perform PCR amplification of the targeted region, and analyze mutations using T7 endonuclease assay, HRMA, or direct sequencing. This approach is particularly valuable for studying specific GRIK2 variants identified in human patients, such as p.Thr660Lys or p.Ala657Thr . For precise mutations, co-inject a donor DNA template containing the desired sequence changes to promote homology-directed repair rather than non-homologous end joining. Functional validation can include electrophysiology on primary neuronal cultures from edited embryos, calcium imaging to assess altered glutamatergic signaling, and examination of morphological and behavioral phenotypes.

How can Xenopus GRIK2 be used to study neurodevelopmental disorders?

Xenopus GRIK2 provides a powerful model system for studying neurodevelopmental disorders associated with human GRIK2 mutations. Recent research has identified specific human disease-associated mutations (p.Ala657Thr, p.Thr660Lys, and p.Thr660Arg) that significantly impact receptor function . These mutations can be introduced into Xenopus GRIK2 using CRISPR-Cas9 or expressed as recombinant receptors in oocytes. Functional characterization should compare electrophysiological properties of wild-type and mutant receptors, examining channel gating kinetics, agonist sensitivity, ion permeability, and protein interactions. Research has shown that human GRIK2 variants like p.Thr660Lys exhibit markedly slowed gating kinetics and are associated with severe epilepsy and hypomyelination . The developmental impact can be analyzed by examining effects on neural tissue morphology, neuronal migration and differentiation, axon guidance, and circuit formation. Behavioral phenotyping in tadpoles can assess swimming patterns, responses to sensory stimuli, and simple learning tasks that might reflect neurodevelopmental impairment. By establishing direct mechanistic links between receptor dysfunction and clinical phenotypes, researchers can potentially identify targets for therapeutic intervention in human patients with similar mutations.

What techniques can visualize GRIK2 trafficking in Xenopus neurons?

Cutting-edge techniques for visualizing GRIK2 trafficking in Xenopus neurons combine advanced imaging with molecular tools. Super-resolution microscopy approaches such as STED (Stimulated Emission Depletion) microscopy achieve resolution below the diffraction limit (~50 nm) to visualize receptor nanoclusters, while PALM/STORM techniques provide single-molecule localization with ~20 nm resolution. Molecular tagging strategies include pH-sensitive GFP variants (pHluorin) for monitoring surface expression and internalization, self-labeling protein tags (SNAP/CLIP/Halo) for pulse-chase experiments, and fluorescent timer proteins to distinguish newly synthesized from older receptor populations. For live imaging, quantum dot labeling enables long-term single-particle tracking, while photoactivatable or photoconvertible fluorescent proteins allow tracking of receptor cohorts from synthesis to degradation. These techniques can be applied to both cultured Xenopus neurons and in vivo imaging in albino tadpoles, which offer optical transparency advantages. The ability to study receptor trafficking is particularly relevant for understanding how disease-associated mutations like p.Thr660Lys or p.Ala657Thr might affect receptor localization and turnover, potentially contributing to the neurodevelopmental phenotypes observed in human patients .

How do GRIK2 receptors interact with other glutamate receptors?

GRIK2 interactions with other glutamate receptors during Xenopus neural development involve complex regulatory relationships that can be studied through complementary approaches. Multiplex in situ hybridization can map temporal and spatial co-expression of GRIK2 with other kainate receptor subunits (GRIK1, GRIK3-5), AMPA receptor subunits (GRIA1-4), NMDA receptor subunits, and metabotropic glutamate receptors. Electrophysiological studies can characterize how GRIK2-containing receptors modulate synaptic AMPA receptor currents, NMDA receptor-dependent calcium influx, and metabotropic glutamate receptor signaling. Research suggests that GRIK2, in association with GRIK3, is involved in presynaptic facilitation of glutamate release at certain synapses . Protein-protein interaction studies should investigate physical interactions between GRIK2 and auxiliary proteins like Neto2, which has been shown to modulate GRIK2 cell surface expression . During development, the balance between different glutamate receptor subtypes is critical for proper circuit formation. Understanding these interactions is particularly important when studying disease-associated mutations, as alterations in one receptor type may have downstream effects on other glutamate receptor systems, potentially amplifying the developmental impact of the primary mutation .

How can GRIK2's role in synaptic plasticity be investigated?

GRIK2's role in Xenopus synaptic plasticity can be investigated through multiple complementary approaches. Long-term potentiation (LTP) and depression (LTD) protocols can be applied to accessible circuits such as retinotectal synapses, which are amenable to in vivo imaging and electrophysiology. Short-term plasticity measurements should include paired-pulse facilitation/depression, frequency-dependent facilitation, and post-tetanic potentiation. Molecular manipulations can involve GRIK2 knockdown/knockout using morpholinos or CRISPR-Cas9, expression of dominant-negative subunits, pharmacological approaches using subtype-specific modulators, and targeted overexpression to assess gain-of-function effects. Learning paradigms for tadpoles can include associative learning protocols (classical conditioning using visual or vibrational stimuli paired with touch) and non-associative learning (habituation to repeated stimuli). Circuit-level analysis may incorporate in vivo calcium imaging during learning tasks, optogenetic manipulation of GRIK2-expressing neurons, and connectome mapping before and after learning protocols. Research indicates that GRIK2 functions in both presynaptic regulation of transmitter release and postsynaptic responses , suggesting multiple potential mechanisms by which it could influence synaptic plasticity and learning.

Why might recombinant GRIK2 show different kinetics in expression systems?

Recombinant GRIK2 may show different kinetics in Xenopus oocytes compared to native receptors due to several methodological factors that researchers should consider. Expression system differences include the lack of neuron-specific post-translational modifications, different membrane composition in oocytes versus neurons, absence of neuronal trafficking machinery, and different calcium handling and second messenger systems. Subunit composition variations are particularly important, as native receptors typically form heteromers with other kainate receptor subunits and associate with auxiliary proteins like Neto2 that modify kinetics . Research has shown that mutations in GRIK2, such as p.Thr660Lys and p.Thr660Arg, exhibit markedly slowed gating kinetics . These effects may be even more pronounced or qualitatively different in native systems compared to oocyte expression systems. Technical considerations include recording temperature differences, solution composition variations (particularly divalent cation concentrations), and slower solution exchange in oocyte recordings that may affect measurement of fast kinetic parameters. To address these issues, researchers should co-express relevant auxiliary proteins and other kainate receptor subunits, optimize recording conditions, and validate key findings in Xenopus neuronal cultures when possible.

How can inconsistent electrophysiological recordings be resolved?

Resolving inconsistent electrophysiological recordings of GRIK2 activity requires systematic troubleshooting across multiple parameters. Oocyte quality and preparation should be standardized, ensuring consistent oocyte stages (V-VI) for all experiments, standardizing collagenase treatment duration and concentration, maintaining strict temperature control during oocyte storage (18°C), and discarding oocytes with abnormal appearance or membrane potential. Expression parameters should be controlled by using consistent mRNA concentration and quality, standardizing post-injection incubation time (typically 2-4 days), and verifying expression levels with Western blotting when possible. Recording conditions must be carefully managed by calibrating perfusion system flow rate and exchange time, preparing fresh solutions regularly, maintaining consistent electrode resistance, and standardizing holding potential and recording temperature. When studying complex channel kinetics as seen with mutant receptors like p.Thr660Lys , consistency in recording conditions becomes even more critical for detecting true biological differences from technical variability. Data analysis approaches should implement blind analysis procedures, use automated analysis software to reduce subjective judgments, establish clear inclusion/exclusion criteria for recordings, and normalize to internal controls when comparing across batches. Statistical considerations include increasing biological replicates (different oocyte batches), increasing technical replicates, and using appropriate statistical tests based on data distribution.

What are common pitfalls in interpreting GRIK2 functional data?

Common pitfalls in interpreting GRIK2 functional data from Xenopus models include several methodological and conceptual challenges. Researchers often overinterpret heterologous expression data by extrapolating oocyte expression results directly to in vivo neuronal function, assuming homomeric receptors in oocytes reflect native heteromeric complexes, and neglecting the role of auxiliary proteins and interacting partners present in neurons . Developmental context misinterpretation includes failing to account for developmental stage-specific effects, not considering the changing glutamatergic system during metamorphosis, and overlooking compensatory mechanisms that may mask phenotypes. Technical limitations that can lead to misinterpretation include attributing solution exchange artifacts to receptor kinetics, misinterpreting desensitization due to inadequate washout between applications, and overlooking voltage-dependent effects when recording at a single potential. When studying disease-associated mutations like p.Ala657Thr or p.Thr660Lys , it's crucial to characterize the full range of functional alterations rather than focusing only on the most obvious changes. Additionally, connecting molecular/cellular phenotypes to circuit and behavioral outcomes requires careful experimental design that bridges these levels of analysis and avoids overly simplistic cause-effect assumptions.

How should species differences be addressed when translating findings?

Addressing species-specific differences when translating Xenopus GRIK2 findings to mammalian systems requires a multi-layered methodological approach. Sequence and structural comparison should include detailed sequence alignment between Xenopus and mammalian GRIK2 homologs, identifying conserved versus divergent domains in ligand binding regions, channel pore, intracellular regulatory domains, and protein interaction motifs. Functional verification should involve parallel testing of Xenopus and mammalian GRIK2 under identical conditions, cross-species expression studies, comparative pharmacology with subtype-specific modulators, and chimeric receptor approaches to isolate domain-specific differences. Contextual considerations include comparing expression patterns across species during equivalent developmental stages, assessing subunit partnership differences, examining auxiliary protein interactions, and considering species-specific signaling pathway variations. Translation validation should confirm key findings in mammalian expression systems, test mechanistic hypotheses in rodent models when possible, and compare findings with available human genetic and clinical data. When studying disease-associated mutations like those found in human GRIK2 (p.Thr660Lys, p.Thr660Arg) , researchers should first confirm that the residue is conserved in Xenopus, then assess whether the mutational effect is consistent across species before making translational claims.

How can single-cell transcriptomics advance GRIK2 research?

Single-cell transcriptomics can revolutionize our understanding of GRIK2 function in Xenopus through several innovative applications. Cell type-specific expression profiling can identify the complete repertoire of cell types expressing GRIK2 throughout development, discover previously unknown GRIK2-expressing populations, define co-expression patterns with other receptor subunits and auxiliary proteins, and map developmental trajectories of GRIK2-expressing neurons. Response to perturbations can be characterized by profiling transcriptional changes following GRIK2 manipulation (knockout/overexpression), cellular responses to kainate or glutamate exposure, compensatory mechanisms following GRIK2 dysfunction, and potential therapeutic targets by identifying convergent pathways. Methodologically, researchers can dissociate Xenopus neural tissue at key developmental stages, perform single-cell RNA sequencing using platforms like 10x Genomics or Drop-seq, implement computational trajectory analysis to track developmental progressions, and validate key findings with spatial transcriptomics or multiplex FISH. This approach could be particularly valuable for understanding how GRIK2 mutations associated with neurodevelopmental disorders affect cellular identity, development, and function at the single-cell level, potentially revealing cell type-specific vulnerabilities and therapeutic opportunities.

What circuit-level approaches are emerging for GRIK2 research?

Promising approaches for studying GRIK2's role in circuit-level functions in Xenopus combine cutting-edge technologies with the unique advantages of this model system. In vivo functional imaging techniques include two-photon calcium imaging in the transparent tadpole brain, genetically-encoded calcium indicators targeted to GRIK2-expressing neurons, voltage imaging with genetically-encoded voltage indicators for millisecond-resolution activity, and simultaneous imaging of multiple neuronal populations during behavior. Circuit manipulation techniques encompass cell type-specific optogenetic activation/inhibition using GRIK2 promoter-driven expression, chemogenetic approaches for sustained modulation of GRIK2-expressing circuits, targeted ablation of specific GRIK2-expressing neuronal populations, and synaptic silencing with tetanus toxin light chain expression. Connectomic approaches include serial electron microscopy reconstruction of GRIK2-expressing circuits, monosynaptic tracing from GRIK2-positive neurons using modified rabies viruses, and barcoding approaches for high-throughput circuit mapping. These approaches would be particularly valuable for understanding how disease-associated mutations in GRIK2 affect neural circuit development and function, potentially explaining the mechanisms underlying associated intellectual disability and developmental delay.

How can optogenetics enhance GRIK2 functional studies?

Combining optogenetics with GRIK2 studies in Xenopus offers powerful ways to dissect receptor function in intact neural circuits. Cell-specific targeting strategies can drive optogenetic tool expression using GRIK2 promoter elements, employ intersectional genetic approaches, use enhancer trap approaches to target GRIK2-expressing neurons, or implement CRISPR knock-in of optogenetic tools into the GRIK2 locus. Illumination and recording methodology can use fiber optics or microscope-based illumination for targeted activation, implement spatial light modulators for patterned activation of specific neurons, combine with electrophysiological recording for direct functional assessment, and pair with calcium imaging for population-level activity monitoring. Experimental design approaches include precisely time-controlled activation of GRIK2-expressing neurons during behavior, synthetic activation patterns to mimic or disrupt natural activity, all-optical interrogation combining optogenetic activation with optical recording, and closed-loop optogenetic manipulation based on behavioral readouts. This methodology would be particularly valuable for understanding how GRIK2 dysfunction in specific neuronal populations, as might occur with pathogenic variants , contributes to circuit-level abnormalities and behavioral phenotypes relevant to neurodevelopmental disorders.

What models are emerging for studying GRIK2 in neurodevelopmental disorders?

Emerging models for studying GRIK2's role in neurodevelopmental disorders using Xenopus leverage both traditional strengths and cutting-edge technologies. Precision disease modeling approaches include CRISPR/Cas9 knock-in of human patient mutations (e.g., p.Thr660Lys, p.Ala657Thr) , F0 mosaic analysis for rapid screening of multiple variants, conditional mutation expression to bypass early developmental requirements, and tissue-specific mutation expression to isolate neural phenotypes. Functional genomics approaches encompass high-throughput in vivo CRISPR screening of GRIK2 pathway components, multiplexed phenotyping of GRIK2 variant effects, synthetic genetic interaction mapping to identify genetic modifiers, and combined knockdown/rescue experiments with human and Xenopus variants. Advanced phenotyping platforms include automated behavioral analysis systems for high-throughput screening, deep phenotyping with machine learning classification of behavioral abnormalities, non-invasive electrophysiology for longitudinal monitoring, and quantitative morphometrics for neural circuit development assessment. These emerging models offer unique advantages for understanding how GRIK2 mutations lead to neurodevelopmental disorders, with the potential to identify novel therapeutic strategies that could be translated to human patients with intellectual disability and developmental delays associated with GRIK2 variants .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.