Recombinant Xenopus laevis Glycerol-3-phosphate acyltransferase 3 (agpat9)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
gpat3; agpat9; Glycerol-3-phosphate acyltransferase 3; GPAT-3; 1-acyl-sn-glycerol-3-phosphate O-acyltransferase 10; AGPAT 10; 1-acyl-sn-glycerol-3-phosphate O-acyltransferase 9; 1-AGP acyltransferase 9; 1-AGPAT 9; Lysophosphatidic acid acyltransferase theta; LPAAT-theta
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-446
Protein Length
full length protein
Species
Xenopus laevis (African clawed frog)
Target Names
gpat3
Target Protein Sequence
MEDFKTIACNIFIIWLTLVIVLILLPSMFGSSLGISEVYMKILVKVLEWATLRIQKGFKD KEKLSASNGIIQRDKSPMETEIECLRQSRSQDIREGDFELGDVFYFAKKGFEAIVEDEVT QRFSSEELISWNLLTRTNNNFHYVSLRVTLIWVLGLCVRYCILLPLRITLATIGISWLVL GATLVGQLPNSRMKSWFSELVHLMCCRICARALSSAIQYHNKENKPKKGGICVANHTSPI DIIILANDGCYAMVGQVHGGLMGIIQRAMARACPHVWFERSEMRDRHLVTERLREHVSDK SKLPILIFPEGTCINNTSVMMFKKGSFEIGGTIYPVAIKYDPQFGDAFWNSSKNSMVSYL LRMMTSWALKCNVWYLPPVNRQDGEDAVQFANRVKSAIAKQGGLVELPWDGGLKRGKVKD SFKEEQQKNYSRIIAGENKSLKPTTH
Uniprot No.

Target Background

Function

This recombinant Xenopus laevis Glycerol-3-phosphate acyltransferase 3 (agpat9) catalyzes the conversion of glycerol-3-phosphate to 1-acyl-sn-glycerol-3-phosphate (lysophosphatidic acid or LPA) by acylation at the sn-1 position of the glycerol backbone. It also converts LPA to 1,2-diacyl-sn-glycerol-3-phosphate (phosphatidic acid or PA) through acylation at the sn-2 position.

Database Links

KEGG: xla:447316

UniGene: Xl.48703

Protein Families
1-acyl-sn-glycerol-3-phosphate acyltransferase family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

Why is Xenopus laevis a suitable model organism for studying Glycerol-3-phosphate acyltransferase 3?

Xenopus laevis offers several significant advantages as a model organism for studying proteins like Glycerol-3-phosphate acyltransferase 3. The eggs and embryos of X. laevis are relatively large and robust, developing externally in simple salt solutions, making them exceptionally amenable to micromanipulation, injection, grafting, and labeling. The ability of Xenopus embryos to translate injected synthetic mRNA has been particularly valuable for investigating protein function in vivo. These characteristics have established Xenopus as a key model organism that has contributed significantly to our understanding of early developmental events and related molecular mechanisms .

What genomic resources are available for Xenopus laevis research related to agpat9?

Multiple genomic resources are available for researchers studying agpat9 in Xenopus laevis. The X. laevis genome has been sequenced from two distinct genetic backgrounds: the inbred J-strain developed for immunological research and an outbred wild-type female. The latest genome assembly (version 9.1) has most of the genome assembled into chromosome-scale scaffolds with 45,099 primary gene models .

Several database resources provide access to Xenopus genomic data:

Database PlatformX. laevis Assembly VersionsFeatures
Xenbase6, 7.2, 9.1, O1 (outbred)Comprehensive model organism database
UCSC Genome Browser7.2, 9.1Visualization and comparative genomics
Ensembl9Gene annotation and evolutionary tools
JBrowse XL9Interactive genome visualization
XenMine7.1, 8.3Data mining and integration

These resources allow researchers to access the agpat9 gene sequence, examine its genomic context, and compare polymorphisms between different Xenopus strains. For optimal experimental design when targeting agpat9, researchers should verify the target sequence in their specific Xenopus stocks or consider obtaining the inbred J-strain from national Xenopus stock centers to ensure sequence compatibility with published genomes .

How does Xenopus laevis agpat9 compare to related acyltransferases in Xenopus and other species?

Xenopus laevis agpat9 (also known as GPAT-3) belongs to a family of acyltransferases that includes other members like glyceronephosphate O-acyltransferase (Gnpat) and glycerol 3-phosphate acyltransferase mitochondrial (gpam or gpat1). While these enzymes share some functional similarities in lipid metabolism, they have distinct expression patterns and subcellular localizations that suggest specialized roles.

In Xenopus, a related enzyme, Gnpat, is expressed in proliferative cells of the retina and lens during development, and post-embryogenesis in proliferative cells of the ciliary marginal zone and lens epithelium. In contrast, gpam expression is mainly restricted to photoreceptors . This differential expression suggests these enzymes have specialized functions in different tissues, particularly in the eye.

Xenopus Gnpat, when expressed in yeast, is present in both soluble and membrane fractions, but only the membrane-bound enzyme displays activity. Additionally, the amino terminal of Gnpat shows lipid binding capacity that is enhanced by phosphatidic acid . This characteristic may be shared with agpat9, given their related functions in lipid metabolism.

The conservation of these enzymes across species highlights their biological importance. The Xenopus agpat9 sequence shows homology to human and other vertebrate GPAT3/AGPAT9 proteins, suggesting evolutionary conservation of function in lipid metabolism pathways across species .

What approaches can be used to express and purify Recombinant Xenopus laevis agpat9?

Producing recombinant Xenopus laevis agpat9 requires careful consideration of expression systems and purification strategies due to its membrane-associated nature. Based on research with related acyltransferases, several approaches can be effective:

Expression Systems:

  • Yeast Expression System: Heterologous expression in yeast has been successfully used for Xenopus Gnpat, a related acyltransferase. This system allows proper folding and membrane association of the protein. When using this approach, it's important to note that the enzyme may partition between soluble and membrane fractions, with only the membrane-bound form displaying activity .

  • Bacterial Expression: For partial protein domains or soluble fragments, E. coli-based expression may be used, though this may not be optimal for the full-length membrane-associated protein.

  • Baculovirus-Insect Cell System: For higher eukaryotic protein production with proper post-translational modifications.

Purification Strategy:

  • Begin with membrane fraction isolation using differential centrifugation

  • Solubilize the protein using appropriate detergents (e.g., DDM, CHAPS)

  • Purify using affinity chromatography based on fusion tags

  • Consider including glycerol in storage buffers (50% glycerol is used for commercially available recombinant protein)

  • Store at -20°C or -80°C for extended storage

A key methodological consideration is the addition of fusion tags, which should be designed to minimize interference with enzyme activity. The tag type may be determined during the production process to optimize for both yield and activity .

What assays can be used to measure agpat9 enzymatic activity?

Measuring the enzymatic activity of Xenopus laevis Glycerol-3-phosphate acyltransferase 3 requires specific assays that detect the transfer of acyl groups to glycerol-3-phosphate. Several complementary approaches can be employed:

Radiochemical Assay:

  • Incubate the enzyme with radiolabeled [14C]glycerol-3-phosphate and acyl-CoA

  • Extract lipids using organic solvents

  • Separate products by thin-layer chromatography

  • Quantify radiolabeled lysophosphatidic acid formation by scintillation counting

Spectrophotometric Coupled Assay:

  • Link the release of CoA during the acyltransferase reaction to the reduction of 5,5'-dithiobis-(2-nitrobenzoic acid) (DTNB)

  • Measure the increase in absorbance at 412 nm

  • Calculate activity based on the rate of color development

Mass Spectrometry-Based Assay:

  • Incubate the enzyme with glycerol-3-phosphate and acyl-CoA

  • Extract lipids and analyze by LC-MS/MS

  • Identify and quantify lysophosphatidic acid products

  • Compare substrate specificity using different acyl-CoA donors

When designing these assays, researchers should consider that the membrane-bound form of related acyltransferases shows activity while the soluble form may not, suggesting the importance of proper membrane environment for enzyme function . Additionally, optimization of buffer conditions, including pH, ionic strength, and presence of divalent cations, is crucial for obtaining reproducible activity measurements.

How can CRISPR-Cas9 be optimized for targeted gene editing of agpat9 in Xenopus laevis?

Designing CRISPR-Cas9 gene editing strategies for agpat9 in Xenopus laevis requires careful consideration due to the pseudotetraploid nature of its genome. An optimized approach should include:

Guide RNA Design Considerations:

  • Identify conserved regions in agpat9 gene to target both homeologs simultaneously

  • Verify target sequences in your specific Xenopus stock, as polymorphisms can affect guide RNA efficiency

  • Consider using the J-strain genome (v9.1) as reference and BLAST the target region against the outbred X. laevis genome to identify conserved regions lacking sequence differences

  • Design multiple guide RNAs targeting different exons to increase editing efficiency

Practical Implementation:

  • Inject CRISPR-Cas9 components into fertilized Xenopus eggs at the one-cell stage

  • Use T7 endonuclease assay or targeted sequencing to verify editing efficiency

  • Raise F0 mosaic animals and breed to establish stable lines

  • Characterize phenotypes in relation to lipid metabolism and development

For optimal results, researchers should consider obtaining inbred J-strain X. laevis from national Xenopus stock centers (NXR, EXRC, or NBRP) to ensure their experimental animals have the same DNA sequence as the published genome . This approach mitigates the risk of off-target effects due to sequence polymorphisms and improves reproducibility across laboratories.

What are the tissue-specific expression patterns of agpat9 during Xenopus development and how can they be studied?

Understanding the tissue-specific expression patterns of agpat9 during Xenopus development requires integrating multiple experimental approaches:

Methodological Approaches:

  • Whole-mount in situ hybridization: This technique can reveal spatial expression patterns of agpat9 throughout embryonic development. Large-scale expression screens have successfully identified synexpression groups in Xenopus, and similar approaches could place agpat9 within functional pathways .

  • Quantitative RT-PCR: For precise quantification of expression levels across developmental stages and in different tissues.

  • RNA-seq analysis: This approach can provide comprehensive transcriptomic profiles and identify co-expressed genes that may function in the same pathways as agpat9.

  • Reporter gene constructs: Transgenic approaches in Xenopus allow visualization of gene expression patterns in living embryos. The development of efficient methods for generating transgenic Xenopus embryos makes this approach particularly valuable .

Based on studies of related acyltransferases, we might expect differential expression patterns across tissues. For instance, gnpat shows expression in proliferative cells of the retina and lens during development, while gpam expression is mainly restricted to photoreceptors . This suggests that acyltransferases like agpat9 may have tissue-specific roles in lipid metabolism during development.

Understanding these expression patterns can provide insights into the functional roles of agpat9 in lipid metabolism during specific developmental processes, potentially revealing its involvement in organogenesis and tissue differentiation.

How does agpat9 function relate to lipid-associated developmental disorders in Xenopus and other vertebrates?

The function of agpat9 in lipid metabolism potentially links it to various developmental disorders, particularly those affecting organs with high lipid requirements. Research on related enzymes provides important context:

Plasmalogens (Plgs) are highly abundant lipids in the retina, and their deficiency leads to severe abnormalities during eye development. The first acylation step in Plgs synthesis involves the enzyme glyceronephosphate O-acyltransferase (GNPAT). GNPAT deficiency produces rhizomelic chondrodysplasia punctata type 2, a genetic disorder associated with developmental ocular defects . As agpat9 is also involved in lipid metabolism pathways, it may similarly impact development, particularly in tissues with high lipid requirements.

The differential expression patterns of acyltransferases in the Xenopus eye (with gnpat in proliferative cells and gpam in photoreceptors) suggest specialized roles in supporting the lipid requirements of different cell types during development . By analogy, agpat9 may have tissue-specific functions that, when disrupted, could contribute to developmental abnormalities.

To investigate these relationships, researchers could:

  • Generate agpat9 knockdown or knockout Xenopus embryos to characterize developmental phenotypes

  • Analyze lipid profiles in affected tissues using lipidomics approaches

  • Perform rescue experiments with wild-type or mutant agpat9 to establish structure-function relationships

  • Compare phenotypes with human lipid metabolism disorders to identify conserved pathological mechanisms

This research would not only advance understanding of fundamental lipid metabolism but could also provide insights into human developmental disorders with dysregulated lipid metabolism.

What are promising research directions for understanding agpat9 regulation in Xenopus development?

Future research on agpat9 regulation in Xenopus development could explore several promising directions:

Transcriptional Regulation:

  • Identify transcription factors that regulate agpat9 expression during specific developmental stages

  • Map the promoter and enhancer elements controlling tissue-specific expression

  • Investigate epigenetic modifications that influence agpat9 expression patterns

Post-translational Modifications:

  • Characterize phosphorylation, glycosylation, or other modifications that might regulate enzyme activity

  • Identify interacting proteins that modulate agpat9 function or localization

  • Determine how membrane composition affects enzyme activity and substrate specificity

Integration with Developmental Signaling Pathways:

  • Explore the relationship between agpat9 and major developmental signaling pathways (Wnt, FGF, TGFβ/BMP)

  • Investigate how agpat9-mediated lipid metabolism contributes to cell fate decisions and morphogenesis

  • Examine the role of agpat9 in metabolic adaptation during developmental transitions

The established genomic resources and transgenic methods for Xenopus provide powerful tools for these investigations . Additionally, the availability of both X. laevis (pseudotetraploid) and X. tropicalis (diploid) as complementary model systems offers unique advantages for genetic and functional studies of agpat9 regulation.

How can multi-omics approaches be integrated to understand agpat9 function in the broader context of lipid metabolism?

Integrating multi-omics approaches can provide a comprehensive understanding of agpat9 function within the broader lipid metabolism network:

Integrated Multi-omics Strategy:

  • Genomics: Utilize the well-characterized Xenopus genome resources to identify regulatory elements and genetic variants affecting agpat9 expression

  • Transcriptomics: Apply RNA-seq to identify co-expressed genes and regulatory networks. Large-scale expression screens in Xenopus have already successfully identified synexpression groups, which could help place agpat9 within functional pathways

  • Proteomics: Employ mass spectrometry to:

    • Identify protein-protein interactions with agpat9

    • Characterize post-translational modifications

    • Quantify changes in protein abundance across developmental stages

  • Lipidomics: Implement targeted and untargeted lipidomics to:

    • Profile changes in lipid composition resulting from agpat9 manipulation

    • Identify specific lipid species affected by agpat9 activity

    • Correlate lipid changes with developmental phenotypes

  • Metabolomics: Analyze broader metabolic changes to understand how agpat9-mediated lipid metabolism integrates with other metabolic pathways

Data integration from these multiple platforms, potentially using machine learning approaches, could reveal the broader metabolic context of agpat9 function and its relationship to developmental processes. This systems biology approach would be particularly valuable for understanding how disturbances in lipid metabolism contribute to developmental disorders.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.