Recombinant Xenopus laevis GRAM domain-containing protein 4 (gramd4)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which serves as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If a specific tag type is required, please inform us; we will prioritize its development.
Synonyms
gramd4; GRAM domain-containing protein 4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-578
Protein Length
full length protein
Species
Xenopus laevis (African clawed frog)
Target Names
gramd4
Target Protein Sequence
MLKRLDKIRFRGQKRDDFLDLVESPNASDTECGDEIPMKIPPTSLKDTEELKDPAGSGTI IMASGVAEYNRTESDRLNEVKGHLEIALLEKHFLQEELRKLREETNIDTLKQELEKERQR RTELEQKITDIAKTRTDESATQQLSKGPSQTNGADKQRSKTMCYRVQKWFYDKFGEYIED FRFQPEECTVETEEPLSARRLTENMRRLKRGAKPVTNFVKNLSALSDWHSVYTSAIAFII YMNAVWHGWAIPMFLFLAILRLSLNYLIARGWRIQWSIVPQVSETLELPKEDLTVSEKFQ LVLDVAQKAQNLFGKMADILEKIKNLFMWVQPEMTQKLYIGLWAAFVASCFFHYKTIGLC MGLYAGIKFFLIDFIFKRCPRLRAKYDTPYIIWTSLPTDPQLKERTNATSSRRIQTVYSR GNLASSAPQGVSRDEETGRFHSTKKSSFHEIFSLLETERPLPACETGWRCCLINRDRKMP TDYIRNGILYVTENFLCFESSRSGSSKRNKVIKLTDITDIQKYKVLSVLPGSGMGIAVST PSTQKPLVFGAMVHRDEAFETIFSQYVKITSAVTNSDT
Uniprot No.

Target Background

Function
Functions as a mediator of E2F1-induced apoptosis in the absence of p53/TP53.
Database Links

KEGG: xla:100037148

UniGene: Xl.74435

Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is GRAMD4 in Xenopus laevis and what cellular functions is it associated with?

GRAMD4 (GRAM domain-containing protein 4) in Xenopus laevis is a homolog of the human pro-apoptotic protein PNAS-4. It functions as a death-inducing protein involved in apoptotic mechanisms. The protein contains a GRAM domain characteristic of membrane-associated proteins and is sometimes referred to as "DIP" (death-inducing protein) in the literature . Based on studies in other species, GRAMD4 appears to be involved in several cellular functions:

  • Regulation of apoptotic pathways

  • Possible involvement in embryonic development

  • Potential tumor suppression activity by recruiting E3 ligase proteins

Research in human models has shown that GRAMD4 inhibits tumor metastasis by recruiting the E3 ligase ITCH to promote TAK1 ubiquitination and degradation, leading to inactivation of MAPK and NF-κB signaling pathways . Similar molecular interactions may exist in Xenopus models, though specific studies in X. laevis are still emerging.

How is GRAMD4 expressed during Xenopus laevis embryonic development?

While specific GRAMD4 expression patterns during X. laevis development are not extensively documented in the provided search results, studies on related proteins suggest that expression analysis can be performed using techniques such as whole-mount in situ hybridization (WMISH). Similar apoptotic proteins like PNAS-4 have been detected in X. laevis embryos using Western blotting with specific polyclonal antibodies .

Based on research methodologies commonly used with Xenopus embryos, expression analysis would likely reveal:

  • Temporal expression patterns through developmental stages

  • Spatial expression in specific tissue types

  • Potential regulation during key developmental transitions

Expression analysis methods such as WMISH could determine if GRAMD4 shows specific localization patterns during embryogenesis, similar to how other proteins like Prdm15 are expressed in the animal pole at stage 5 and in the dorsal neural tissue and anterior neural plate at stage 13 .

What are the recommended methods for cloning and expressing recombinant Xenopus laevis GRAMD4?

For successful cloning and expression of recombinant X. laevis GRAMD4, researchers should consider a protocol similar to that used for other X. laevis proteins, such as xPNAS-4 :

Expression System Selection:

  • E. coli is commonly used for recombinant protein expression of Xenopus proteins

  • The protein can be expressed with a histidine tag to facilitate purification

Cloning Procedure:

  • Isolate total RNA from X. laevis embryos or tissues

  • Perform RT-PCR to amplify the GRAMD4 coding sequence

  • Clone the amplified sequence into an appropriate expression vector

  • Transform E. coli with the recombinant plasmid

Expression and Purification:

  • Express recombinant His-tagged GRAMD4 in E. coli (typically forms insoluble inclusion bodies)

  • Solubilize inclusion bodies using 8M urea

  • Purify using Ni²⁺ affinity chromatography to near homogeneity

  • Refold the denatured protein by stepwise dilution of urea concentration via dialysis

This procedure typically yields approximately 4 mg of refolded protein per liter of E. coli culture with a purity of about 95%. The purified protein can be identified by liquid chromatography-electrospray ionization-quadrupole-time of flight-mass spectrometry (LC-ESI-Q-TOF-MS) .

How can polyclonal antibodies against Xenopus laevis GRAMD4 be generated and validated?

Generating and validating polyclonal antibodies against X. laevis GRAMD4 involves several critical steps:

Antibody Production:

  • Immunize rabbits or other suitable animals with purified recombinant GRAMD4 protein

  • Collect serum after sufficient time for antibody production

  • Purify antibodies using affinity chromatography with immobilized GRAMD4

Validation Methods:

  • Western Blotting: Confirm antibody specificity against purified recombinant GRAMD4 and X. laevis embryo/tissue lysates

  • Immunoprecipitation: Test antibody capacity to pull down native GRAMD4 from X. laevis lysates

  • Immunohistochemistry: Validate tissue localization patterns in X. laevis embryos or sections

Controls for Validation:

  • Pre-immune serum as negative control

  • Blocking with recombinant GRAMD4 to confirm specificity

  • Using GRAMD4-depleted samples (e.g., from morpholino knockdown experiments)

The resulting antibodies should be suitable for detecting the expression of GRAMD4 in X. laevis embryos by Western blotting, similar to how anti-xPNAS-4 polyclonal antibodies were developed .

How can GRAMD4 function be investigated through gene knockdown in Xenopus laevis?

Investigating GRAMD4 function through gene knockdown in X. laevis can be accomplished through several approaches, with morpholino oligonucleotides (MOs) being particularly effective:

Morpholino Oligonucleotide (MO) Approach:

  • Design antisense MOs targeting the translation start site or splice junctions of GRAMD4 mRNA

  • Inject MOs unilaterally into one dorsal animal blastomere at the eight-cell stage

  • Co-inject GFP RNA (0.5 ng) to monitor injection efficiency

  • Include control MO (CoMO) experiments that cannot bind to any X. laevis mRNA

  • Analyze phenotypes at appropriate developmental stages

CRISPR/Cas9 System Alternative:

  • Design sgRNAs targeting GRAMD4 coding sequence

  • Co-inject sgRNAs with Cas9 protein or mRNA

  • Validate gene editing efficiency by sequencing

  • Compare phenotypes with MO knockdown results to confirm specificity

Validation of Knockdown:

  • Confirm GRAMD4 protein reduction by Western blotting

  • Perform rescue experiments by co-injecting MO-resistant GRAMD4 mRNA

  • Analyze dose-dependent effects of different MO concentrations

For phenotypic analysis, researchers should examine multiple parameters including morphological abnormalities, tissue-specific defects, and changes in expression of related genes. Additional biochemical assays may be needed to determine if the GRAMD4 knockdown affects apoptotic pathways or other cellular processes .

What approaches can be used to study potential interactions between GRAMD4 and other proteins in Xenopus laevis?

To investigate protein-protein interactions involving GRAMD4 in X. laevis, researchers can employ several complementary approaches:

Co-immunoprecipitation (Co-IP):

  • Prepare protein lysates from X. laevis embryos or tissues

  • Immunoprecipitate GRAMD4 using validated anti-GRAMD4 antibodies

  • Analyze co-precipitated proteins by mass spectrometry

  • Confirm specific interactions by Western blotting

Yeast Two-Hybrid (Y2H) Screening:

  • Clone GRAMD4 as bait in appropriate Y2H vectors

  • Screen against a X. laevis cDNA library

  • Validate positive interactions by secondary assays

  • Confirm interactions in X. laevis embryos or cells

In vivo Approaches:

  • Co-inject mRNAs encoding GRAMD4 and potential interacting proteins

  • Use fluorescence resonance energy transfer (FRET) with tagged proteins

  • Perform proximity ligation assays in X. laevis tissues

Based on studies in mammalian systems, potential interacting partners to investigate might include E3 ubiquitin ligases like ITCH, as GRAMD4 has been shown to recruit ITCH to promote TAK1 ubiquitination in human cells . Researchers should specifically examine if GRAMD4 in X. laevis interacts with components of apoptotic pathways or ubiquitination machinery.

How do researchers address data contradictions between different experimental approaches when studying GRAMD4?

Addressing data contradictions in GRAMD4 research requires systematic analysis and multiple validation approaches:

Common Sources of Data Contradiction:

  • Differences between in vitro and in vivo findings

  • Variations in results between different knockdown methods (MO vs. CRISPR)

  • Discrepancies between expression data and functional studies

  • Conflicting results across different developmental stages

Resolution Strategies:

  • Cross-validation of techniques:

    • Compare GRAMD4 knockdown phenotypes using both MO and CRISPR/Cas9

    • Validate protein interactions with multiple methodologies (Co-IP, Y2H, FRET)

  • Quantitative analysis:

    • Use statistical methods to evaluate the significance of observations

    • Perform computer-based measurement of expression areas and intensities

  • Rescue experiments:

    • Test if wild-type GRAMD4 can rescue knockdown phenotypes

    • Compare rescue efficiency with mutant versions of GRAMD4

  • Independent data confirmation:
    Table: Confirmation rates between experimental techniques (adapted from )

    Technique CombinationTypical Confirmation RateNotes
    MS and GFP datasets<4% for most compartments20% for nuclear proteins
    MO and CRISPR/Cas9Varies by targetShould be validated with rescue
    Expression vs. functionOften divergentRequires multiple approaches

The level of independent confirmation between different datasets is typically low (<4%), with notable exceptions for nuclear proteins (20%). This highlights the importance of using multiple, complementary approaches when studying GRAMD4 .

What are the key considerations for designing experiments to study GRAMD4's role in apoptotic pathways in Xenopus laevis?

Designing robust experiments to investigate GRAMD4's role in apoptotic pathways in X. laevis requires careful consideration of several factors:

Experimental Design Considerations:

  • Developmental timing:

    • Select appropriate developmental stages for study (e.g., early embryogenesis, metamorphosis)

    • Consider stage-specific apoptotic events that occur naturally

  • Tissue specificity:

    • Target manipulations to tissues where GRAMD4 is expressed

    • Compare effects across different tissue types

  • Overexpression studies:

    • Use inducible or tissue-specific promoters to control expression

    • Compare wild-type vs. mutant GRAMD4 constructs

    • Monitor dose-dependent effects

  • Apoptosis assays:

    • TUNEL assays to detect DNA fragmentation

    • Caspase activity assays

    • Mitochondrial membrane potential changes

    • Phosphatidylserine externalization (Annexin V staining)

  • Controls and validation:

    • Include both negative controls (uninjected, control MO) and positive controls (known apoptosis inducers)

    • Validate apoptotic effects with multiple independent assays

    • Use chemical inhibitors of apoptosis as additional controls

  • Integration with signaling pathways:

    • Investigate relationships with known apoptotic regulators

    • Test if GRAMD4 effects are dependent on specific caspases

    • Examine potential cross-talk with other signaling pathways (e.g., MAPK, NF-κB)

Based on research in human cells, where GRAMD4 inhibits tumor metastasis by recruiting E3 ligase ITCH to promote TAK1 degradation , researchers should specifically examine if similar mechanisms exist in X. laevis and how they might regulate apoptotic pathways during development.

How can transgenic approaches be utilized to study GRAMD4 function in Xenopus laevis development?

Transgenic approaches offer powerful tools for studying GRAMD4 function throughout X. laevis development:

Transgenic Methods in X. laevis:

  • Restriction Enzyme-Mediated Insertion (REMI):

    • Mix transgene DNA with permeabilized sperm, restriction enzyme, and egg extract

    • Inject into unfertilized dejellied eggs

    • Allows large-scale transgenesis with correct spatial and temporal regulation

  • "Sleeping Beauty" Transposase System:

    • Co-inject transposase mRNA and vector containing GRAMD4 transgene

    • Screen larvae for expression with fluorescence microscopy

    • Can be used with isogenetic X. laevis clones (e.g., LG-6, LG-15)

Advanced Transgenic Applications for GRAMD4:

  • Tissue-specific expression:

    • Use tissue-specific promoters to express GRAMD4 in targeted regions

    • Examples include neural-specific (N-β-tubulin), epidermal (keratin), or ubiquitous (EF-1α) promoters

  • Inducible expression systems:

    • Employ heat-shock promoters or chemical induction systems (e.g., Tet-On/Off)

    • Allow temporal control of GRAMD4 expression at specific developmental stages

  • Reporter fusions:

    • Create GRAMD4-GFP fusion proteins to visualize subcellular localization

    • Use split-reporter systems to detect protein-protein interactions in vivo

  • CRISPR/Cas9 knock-in:

    • Generate precise modifications of the endogenous GRAMD4 locus

    • Create point mutations to study specific domain functions

When designing transgenic approaches, researchers should consider that the transgene is usually integrated into the male genome prior to fertilization in X. laevis, resulting in non-chimeric embryos without requiring breeding of animals .

What techniques can be used to analyze the potential role of GRAMD4 in cell signaling pathways during Xenopus laevis development?

Analyzing GRAMD4's role in cell signaling pathways during X. laevis development requires integrating multiple technical approaches:

Molecular and Biochemical Approaches:

  • Pathway component analysis:

    • Western blotting for phosphorylated signaling proteins (e.g., MAPKs, NF-κB components)

    • Analyze changes in signaling pathway components following GRAMD4 manipulation

    • Use chemical inhibitors to test pathway dependencies

  • Gene expression analysis:

    • RNA-Seq of GRAMD4-manipulated embryos at different developmental stages

    • qRT-PCR validation of pathway target genes

    • Whole-mount in situ hybridization to assess spatial changes in pathway component expression

  • Chromatin immunoprecipitation (ChIP):

    • Determine if GRAMD4 associates with chromatin

    • Identify potential transcriptional targets

Functional Analysis Techniques:

  • Rescue experiments:

    • Test if pathway components can rescue GRAMD4 knockdown phenotypes

    • Example from related research: Wnt4 RNA co-injection rescued Prdm15 morpholino-induced reduced gene expression

    Table: Example of signaling pathway rescue experiments (adapted from )

    GeneStageExpression Area Change with GRAMD4 KDRescue with Pathway Componentp-value
    rax13ReducedPartial≤0.01**
    pax613ReducedSignificant≤0.001***
    snai220ReducedSignificant≤0.0001****
    foxd323ReducedSignificant≤0.0001****
  • Ubiquitination and protein stability analysis:

    • Investigate if GRAMD4 affects ubiquitination of signaling proteins

    • Analyze protein half-life changes in presence/absence of GRAMD4

    • Based on human studies, GRAMD4 may recruit E3 ligases like ITCH to promote degradation of signaling proteins such as TAK1

  • Imaging approaches:

    • Live imaging of tagged signaling components with/without GRAMD4

    • FRET-based reporters to monitor pathway activity in real-time

By combining these approaches, researchers can build a comprehensive understanding of how GRAMD4 interfaces with signaling networks during Xenopus development, potentially revealing conserved mechanisms across vertebrate species.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.