Recombinant Xenopus laevis Heme transporter hrg1-B (slc48a1-b)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization

Recombinant hrg1-B is derived from the African clawed frog (Xenopus laevis) and belongs to the solute carrier family 48 (SLC48A1). Key molecular features include:

PropertyDetails
UniProt IDQ4FZW7
Gene Nameslc48a1-b (synonym: hrg1-b)
Protein LengthFull-length (1–145 aa)
Amino Acid SequenceMAVTKQLWIRIIYAAVGTLFGLSAFLVWNVAFVQPWTAAMGGLSGVLALWALITHIMYVQDFWRTWLKGLRFFLCIGVLFFVLALVAFITFLAVAISEKQSISDPKSLYLSCVWSFMSMKWAFLLSLYSYRYRKEFADISILSDF
TagN-terminal 10xHis tag (determined during production)
Expression SystemEscherichia coli
Storage-20°C (short-term); -80°C (long-term) in Tris-based buffer with 50% glycerol

Functional Role in Heme Transport

Hrg1-B facilitates heme transport across endolysosomal membranes, crucial for iron recycling and cellular homeostasis:

  • Mechanism: Transports heme from phagolysosomes to the cytoplasm, enabling iron liberation via heme oxygenases .

  • Biological Relevance:

    • Regulates BACH2 transcription factor activity by modulating its phosphorylation and protein interactions .

    • Essential for oligodendrocyte myelination, as shown in murine studies where Hrg1 deficiency caused myelin defects and reduced iron levels .

    • Highly expressed in mature oligodendrocytes compared to precursors, suggesting a role in myelin maintenance .

Research Applications

This recombinant protein is widely used in:

In Vitro Assays

  • Binding Studies: Direct interaction assays with TBK1 kinase and DNMT1 methyltransferase, enhanced by heme .

  • Electrophoretic Mobility Shift Assays (EMSAs): Validates BACH2 binding to Slc48a1 MARE regions .

Therapeutic Insights

  • Iron Homeostasis: Dysregulation linked to neurodegenerative and hematologic disorders .

  • Gene Regulation: BACH2 represses Slc48a1 transcription, creating a feedback loop for heme-dependent immune responses .

Comparative Analysis Across Species

SpeciesProteinKey Differences
Xenopus laevishrg1-B (slc48a1-b)145 aa, optimized for amphibian heme transport
Rattus norvegicusHrg1 (Slc48a1)146 aa, 89% sequence similarity; critical for oligodendrocyte iron uptake
Homo sapiensHRG1 (SLC48A1)Associated with iron overload disorders; expressed in macrophages for erythrophagocytosis

Handling and Stability

  • Reconstitution: Lyophilized powder requires resuspension in Tris/PBS buffer with 50% glycerol .

  • Stability: Degrades upon repeated freeze-thaw cycles; working aliquots stable at 4°C for ≤1 week .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference in the order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Kindly consult your local distributors for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C, and aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize the development of your specified tag.
Synonyms
slc48a1-b; hrg1-b; Heme transporter hrg1-B; Heme-responsive gene 1 protein homolog B; HRG-1B; Solute carrier family 48 member 1-B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-145
Protein Length
full length protein
Species
Xenopus laevis (African clawed frog)
Target Names
slc48a1-b
Target Protein Sequence
MAVTKQLWIRIIYAAVGTLFGLSAFLVWNVAFVQPWTAAMGGLSGVLALWALITHIMYVQ DFWRTWLKGLRFFLCIGVLFFVLALVAFITFLAVAISEKQSISDPKSLYLSCVWSFMSMK WAFLLSLYSYRYRKEFADISILSDF
Uniprot No.

Target Background

Function
Heme transporter that regulates intracellular heme availability through the endosomal or lysosomal compartment.
Database Links

KEGG: xla:735139

UniGene: Xl.6971

Protein Families
HRG family
Subcellular Location
Endosome membrane; Multi-pass membrane protein. Lysosome membrane; Multi-pass membrane protein.

Q&A

What is Xenopus laevis Heme Transporter HRG1-B and how does it relate to other HRG proteins?

Xenopus laevis Heme Transporter HRG1-B (SLC48A1-B) is a transmembrane protein involved in cellular heme transport and homeostasis. It belongs to the HRG (Heme Responsive Gene) family of proteins that were initially identified in Caenorhabditis elegans. The protein consists of 145 amino acids and contains four predicted transmembrane domains with specific residues that may directly bind heme (such as histidine in transmembrane domain 2) or interact with heme side chains (FARKY motif in the C-terminal tail) . The HRG1 family is evolutionarily conserved, with HRG1 having orthologs in vertebrates showing approximately 25% amino acid identity, while its paralogs HRG-4, HRG-5, and HRG-6 are nematode-specific . The Xenopus laevis HRG1-B specifically serves as an important model for studying heme transport mechanisms in vertebrate systems.

How is the expression of HRG1/SLC48A1 regulated in response to heme availability?

The expression of HRG1 proteins is tightly regulated by heme availability, although the specific regulation patterns may differ between paralogs and across species. In C. elegans, which serves as a model for understanding HRG1 regulation, hrg-1 is highly responsive to heme deficiency, with its mRNA expression significantly upregulated under low heme conditions . Studies show that while both hrg-1 and its paralog hrg-4 respond strongly to heme deficiency, they exhibit markedly different magnitudes of change in mRNA expression at various heme concentrations .

For instance, hrg-4 mRNA is significantly upregulated (>40 fold) at 4 μM heme but becomes undetectable at 20 and 500 μM heme, demonstrating its extreme sensitivity to environmental heme levels . The hrg-1 gene shows a similar pattern of regulation but with different responsiveness to heme-mediated repression . This differential regulation suggests sophisticated control mechanisms that allow organisms to fine-tune their response to varying heme levels, ensuring appropriate heme homeostasis under different environmental conditions.

How can recombinant Xenopus laevis HRG1-B protein be expressed and purified for research purposes?

Recombinant Xenopus laevis HRG1-B (SLC48A1-B) protein can be expressed and purified using bacterial expression systems, particularly E. coli. The methodology typically involves:

  • Gene Cloning and Vector Construction: The full-length coding sequence (1-145 amino acids) is cloned into an expression vector with an N-terminal His-tag for purification purposes .

  • Expression in E. coli: The recombinant plasmid is transformed into E. coli expression strains, and protein expression is induced under optimized conditions .

  • Protein Purification: The expressed protein is purified using affinity chromatography, typically with Ni-NTA resins that bind the His-tag. This is followed by additional purification steps if higher purity is required .

  • Quality Control: The purified protein is assessed for purity (typically >90%) using SDS-PAGE analysis .

  • Storage and Handling: The purified protein is often lyophilized and can be stored at -20°C/-80°C. For use, it should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL, and 5-50% glycerol is recommended for long-term storage to prevent freeze-thaw damage .

It's important to note that repeated freeze-thaw cycles should be avoided, and working aliquots can be stored at 4°C for up to one week . When reconstituting the protein, brief centrifugation prior to opening the vial is recommended to bring the contents to the bottom .

What functional assays can be used to study heme transport activity of Xenopus laevis HRG1-B?

Several functional assays can be employed to study the heme transport activity of Xenopus laevis HRG1-B:

  • Electrophysiological Assays in Xenopus Oocytes: This is a direct method to measure heme transport. Xenopus laevis oocytes are injected with cRNA encoding HRG1-B, and heme-dependent currents are monitored under a two-electrode voltage clamp . This approach has successfully demonstrated that HRG1 proteins function as heme transporters, as evidenced by strong heme-induced electrophysiological currents .

  • ZnMP Uptake Assays: Zinc Mesoporphyrin (ZnMP), a fluorescent heme analog, can be used to visualize and quantify heme uptake. This assay involves exposing cells or organisms expressing HRG1-B to ZnMP and then measuring fluorescence intensity to assess transport activity . The methodology has been utilized in C. elegans studies where worms were exposed to 5 μM ZnMP plus 1.5 μM hemin chloride for 16 hours, followed by measurement of ZnMP fluorescence intensity .

  • Heme-Responsive GFP Reporter Systems: Transgenic systems using GFP reporters under the control of heme-responsive elements can indirectly assess heme transport by monitoring changes in cellular heme levels. This approach has been used in C. elegans where a transgenic strain expressing hrg-1::gfp fusion serves as a whole-animal heme sensor .

  • Genetic Rescue Experiments: Functional complementation studies, where HRG1-B is expressed in models with heme transport deficiencies, can demonstrate its transport capacity. For example, the ability of worm HRG-1 to rescue phenotypes in zebrafish hrg-1 morphants has provided evidence for its conserved function .

How can GFP reporter constructs be utilized to study HRG1-B expression and localization?

GFP reporter constructs provide powerful tools for studying HRG1-B expression patterns and subcellular localization. The methodology involves:

  • Reporter Fusion Construction: Using Gateway cloning or similar systems, the promoter of HRG1-B is cloned into a vector containing the GFP gene and a 3' untranslated region (such as unc-54 in C. elegans studies) . The construction typically involves:

    • Cloning the promoter of interest into an entry vector (e.g., pDONR P4-P1R)

    • Cloning the gfp gene into another entry vector (e.g., pDONR 221)

    • Cloning the 3' untranslated region into a third entry vector (e.g., pDONR P2R-P3)

    • Recombining these entry clones into a destination vector to produce the final recombinant plasmid

  • Transgenic Animal Generation: The reporter construct is introduced into the organism of interest. In C. elegans, this can be achieved through microparticle bombardment where worms are co-bombarded with the reporter construct and a rescue plasmid (e.g., unc-119 rescue plasmid for unc-119(ed3) worms) . For Xenopus studies, techniques such as microinjection of mRNA or transgenesis may be employed.

  • Visualization and Analysis: Transgenic lines expressing the GFP reporter are observed using fluorescence microscopy to determine:

    • Tissue-specific expression patterns

    • Subcellular localization of the protein

    • Changes in expression in response to varying heme concentrations

    • Co-localization with other cellular markers to identify specific compartments

  • Quantitative Analysis: GFP fluorescence intensity can be measured using instruments like a COPAS Biosort, which sorts worms by their time of flight (axial length) and extinction (optical density), enabling quantitative assessment of expression levels under different conditions .

This approach has been successfully used to create heme sensors in C. elegans (strain IQ6011 expressing hrg-1::gfp) that specifically respond to heme in the growth medium, allowing researchers to interrogate changes in organismal heme homeostasis .

How does Xenopus laevis HRG1-B compare functionally to HRG1 proteins in other species?

Comparative studies of HRG1 proteins across species reveal remarkable functional conservation despite moderate sequence identity:

  • Sequence Homology: Xenopus laevis HRG1-B shares approximately 25% amino acid identity with human HRG1 and other vertebrate orthologs . Despite this relatively low sequence identity, key functional domains and motifs are conserved, particularly those involved in heme binding and membrane topology.

  • Functional Conservation:

    • Electrophysiological studies in Xenopus oocytes have shown that HRG1 proteins from C. elegans, zebrafish, and humans all induce heme-dependent currents, indicating conserved transport function .

    • Cross-species rescue experiments provide compelling evidence for functional conservation. Most notably, C. elegans HRG1 can fully rescue severe phenotypes in zebrafish hrg-1 morphants, including defects in erythropoiesis, brain development, and skeletal formation . This demonstrates that the worm protein can functionally substitute for its zebrafish counterpart despite evolutionary distance.

  • Subcellular Localization: Human and worm HRG1 proteins localize to similar subcellular compartments when expressed in heterologous systems, further supporting their functional conservation . This shared localization is likely directed by conserved sorting signals in the C-terminal region.

  • Heme-Responsive Regulation: While the specific patterns may differ, HRG1 genes across species show heme-responsive regulation, with expression typically upregulated under low heme conditions . This conserved regulatory response underscores the evolutionary importance of these proteins in maintaining heme homeostasis.

The high degree of functional conservation despite moderate sequence identity suggests that HRG1 proteins represent an ancient and fundamental component of cellular heme trafficking pathways that has been maintained throughout animal evolution.

What are the key differences between SLC48A1-B and its paralog HRG-4 in terms of expression and function?

The slc48a1-b (hrg-1b) and hrg-4 genes show several significant differences in their expression patterns and functional characteristics:

These differences highlight the complexity of heme transport systems and suggest that organisms have evolved multiple specialized transporters to handle heme trafficking between different cellular compartments and under varying environmental conditions.

How can Xenopus laevis HRG1-B be used as a model to understand human heme transport disorders?

Xenopus laevis HRG1-B provides a valuable model for understanding human heme transport disorders through several research approaches:

  • Comparative Structure-Function Analysis: Despite moderate sequence identity (~25%), human and Xenopus HRG1 proteins share key functional domains . By studying how specific mutations affect Xenopus HRG1-B function, researchers can make predictions about the impact of corresponding mutations in human HRG1 that might be associated with disorders of heme metabolism.

  • Xenopus Oocyte Expression System: The Xenopus oocyte system allows for direct electrophysiological measurement of heme transport activity . This system can be used to:

    • Characterize transport kinetics of wild-type and mutant HRG1 proteins

    • Assess the functional impact of human HRG1 variants identified in patients with suspected heme transport disorders

    • Screen for compounds that modulate HRG1 activity, potentially identifying therapeutic candidates

  • Developmental Model: Xenopus embryos provide an accessible vertebrate model for studying the developmental consequences of HRG1 dysfunction. Studies in zebrafish have shown that HRG1 deficiency leads to profound defects in erythropoiesis, brain development, and skeletal formation . Similar studies in Xenopus could provide insights into the developmental basis of human disorders associated with heme transport deficiencies.

  • Erythropoiesis Studies: Given that HRG1 plays a crucial role in erythropoiesis in zebrafish , and likely other vertebrates, Xenopus models of HRG1 dysfunction could help elucidate mechanisms underlying human erythropoietic disorders associated with heme metabolism, such as certain forms of anemia.

  • Drug Discovery Platform: The Xenopus system could be utilized for high-throughput screening of compounds that restore function to defective HRG1 variants, potentially identifying therapeutic leads for human heme transport disorders.

By leveraging the evolutionary conservation of HRG1 function while taking advantage of the experimental accessibility of the Xenopus system, researchers can gain valuable insights into the molecular mechanisms of human heme transport disorders and potential therapeutic approaches.

What experimental approaches can be used to investigate the interaction between HRG1-B and other proteins involved in heme homeostasis?

Several sophisticated experimental approaches can be employed to investigate interactions between HRG1-B and other heme homeostasis proteins:

  • Co-immunoprecipitation (Co-IP) Studies:

    • Using tagged versions of HRG1-B (such as the His-tagged recombinant protein) to pull down interacting partners

    • Performing reverse Co-IP with antibodies against suspected interacting proteins

    • Analyzing results with mass spectrometry to identify novel interacting partners

  • Proximity-Based Labeling Techniques:

    • BioID or TurboID, where a biotin ligase is fused to HRG1-B, biotinylating proximal proteins

    • APEX2 proximity labeling, which uses an engineered peroxidase to tag neighboring proteins

    • These techniques are particularly valuable for identifying transient or weak interactions in the native cellular environment

  • Fluorescence Resonance Energy Transfer (FRET):

    • Creating fluorescent protein fusions with HRG1-B and candidate interacting proteins

    • Measuring energy transfer between fluorophores to detect protein-protein interactions

    • This approach provides spatial information about interactions within living cells

  • Split-Protein Complementation Assays:

    • Techniques such as bimolecular fluorescence complementation (BiFC) or split-luciferase assays

    • Fragments of a reporter protein are fused to HRG1-B and potential interacting partners

    • Interaction brings fragments together, restoring reporter activity

  • Genetic Interaction Studies:

    • RNAi screens in C. elegans or other model systems to identify genes that, when knocked down, enhance or suppress HRG1-B phenotypes

    • Such genetic interactions often indicate functional relationships between proteins

    • For example, the functional RNAi screen using the C. elegans heme sensor strain IQ6011 could be adapted to identify genetic interactors of HRG1-B

  • Protein Crosslinking Mass Spectrometry:

    • Chemical crosslinking of interacting proteins followed by mass spectrometry analysis

    • This approach can identify not only interacting partners but also specific interaction interfaces

  • Membrane Yeast Two-Hybrid (MYTH) System:

    • Specialized for membrane proteins like HRG1-B

    • Allows screening for interactors of integral membrane proteins that cannot be assessed with conventional yeast two-hybrid

These complementary approaches can provide a comprehensive picture of the protein interaction network surrounding HRG1-B, revealing how it functions within the broader context of cellular heme homeostasis.

How can advanced imaging techniques be applied to study the dynamics of HRG1-B-mediated heme transport?

Advanced imaging techniques offer powerful approaches to visualize and quantify the dynamics of HRG1-B-mediated heme transport in real time:

  • Fluorescent Heme Analogs and Super-Resolution Microscopy:

    • Zinc Mesoporphyrin (ZnMP), a fluorescent heme analog, can be used to track heme transport in living cells

    • When combined with super-resolution techniques such as STED, PALM, or STORM, this approach can visualize heme trafficking with nanometer precision

    • These techniques can reveal the spatial organization of HRG1-B and heme within cellular compartments at a resolution below the diffraction limit

  • FRAP (Fluorescence Recovery After Photobleaching):

    • By photobleaching fluorescent heme analogs in specific cellular regions and monitoring recovery

    • This technique can measure the mobility and transport rates of heme in different cellular compartments

    • Can determine if HRG1-B affects the diffusion rate of heme across membranes

  • Single-Molecule Tracking:

    • Using quantum dots or other bright, photostable fluorophores conjugated to heme or HRG1-B

    • Tracking individual molecules to observe transport events at the single-molecule level

    • Can reveal heterogeneity in transport behavior that might be masked in ensemble measurements

  • Correlative Light and Electron Microscopy (CLEM):

    • Combining fluorescence imaging of HRG1-B and heme with electron microscopy

    • Provides context for heme transport in relation to ultrastructural features

    • Can identify specific membrane domains or contact sites involved in heme transport

  • Biosensors for Heme:

    • Genetically encoded fluorescent biosensors that change their emission properties upon binding heme

    • When expressed in specific cellular compartments, these sensors can monitor real-time changes in heme concentration

    • Can be combined with HRG1-B manipulations to directly visualize transport activity

  • Two-Photon Microscopy for In Vivo Imaging:

    • Allows deeper tissue penetration for imaging heme transport in intact organisms

    • Particularly useful for studying HRG1-B function in Xenopus embryos or other model systems

    • Can reveal how heme transport dynamics vary across different tissues and developmental stages

  • Light Sheet Microscopy:

    • Enables rapid 3D imaging with minimal phototoxicity

    • Ideal for long-term imaging of heme transport during development or in response to changing heme levels

    • Can capture the dynamics of HRG1-B localization and heme distribution simultaneously across entire embryos

These advanced imaging approaches, particularly when used in combination, can provide unprecedented insights into the spatial and temporal dynamics of HRG1-B-mediated heme transport in cellular and developmental contexts.

How might understanding HRG1-B function contribute to developing new anthelminthic drugs?

Understanding HRG1-B function offers strategic opportunities for developing novel anthelminthic drugs through several promising approaches:

  • Targeting Parasite-Specific Vulnerabilities: Many parasitic helminths, like C. elegans, are natural heme auxotrophs that rely on environmental heme acquisition for survival . The identification of parasite-specific hrg homologs presents an attractive target for drug development . By identifying structural or functional differences between parasite and host HRG proteins, researchers can design compounds that selectively inhibit the parasite transporters while sparing the human orthologs.

  • Disrupting Heme Acquisition Pathways: Parasite survival depends on efficient heme acquisition from the host. Comprehensive understanding of HRG1-B and related transporters can reveal critical nodes in this acquisition pathway that could be pharmacologically targeted. Blocking heme uptake or intracellular trafficking would effectively starve the parasites of this essential cofactor.

  • Structure-Based Drug Design: Detailed structural information about HRG1-B, particularly its heme-binding sites (such as H90 in TMD2 and the FARKY motif in the C-terminal tail) , can guide the rational design of small molecule inhibitors. These inhibitors could be designed to competitively block heme binding or to allosterically alter transporter conformation.

  • High-Throughput Screening Platforms: The established Xenopus oocyte electrophysiology system for measuring HRG1-mediated heme transport could be adapted for medium-throughput screening of compound libraries to identify inhibitors. Additionally, the C. elegans heme sensor strain (IQ6011) could serve as a whole-organism screening platform.

  • Combination Therapy Approaches: Understanding how HRG1-B interacts with other components of heme homeostasis could identify multiple targets for simultaneous inhibition, potentially increasing efficacy and reducing the likelihood of resistance development.

The development of such targeted anthelminthic drugs would address a significant global health need, as helminth infections affect billions of people worldwide, and resistance to existing drugs is an increasing concern.

What role might HRG1-B play in understanding cellular responses to hypoxia or oxidative stress?

HRG1-B likely plays significant roles in cellular responses to hypoxia and oxidative stress through several interconnected mechanisms:

  • Heme Availability During Hypoxia: Hypoxic conditions alter cellular metabolism and can affect heme synthesis and degradation. As a heme transporter, HRG1-B may be crucial for redistributing limited heme resources during hypoxia to prioritize essential hemoproteins . Research could investigate whether HRG1-B expression or localization changes under hypoxic conditions to facilitate this redistribution.

  • Intersection with HIF Signaling Pathways: Hypoxia-inducible factors (HIFs) are master regulators of cellular responses to low oxygen. Several hemoproteins function as oxygen sensors in the HIF pathway. Investigating potential crosstalk between HRG1-B-mediated heme transport and HIF signaling could reveal new regulatory mechanisms in hypoxic responses.

  • Heme's Role in Oxidative Stress: Free heme is highly reactive and can generate reactive oxygen species (ROS), contributing to oxidative stress. HRG1-B may play a protective role by ensuring proper compartmentalization of heme, preventing its accumulation in cellular locations where it could cause oxidative damage. Studies could examine whether cells with altered HRG1-B expression show differential sensitivity to oxidative stressors.

  • Regulation of Antioxidant Responses: Heme is a cofactor for several enzymes involved in antioxidant defense, including catalases and peroxidases. By controlling heme availability to these enzymes, HRG1-B could indirectly modulate cellular antioxidant capacity. Research could assess how HRG1-B deficiency affects the activity of heme-dependent antioxidant enzymes.

  • Potential Role in Erythrophagocytosis: In specialized cells like macrophages that recycle heme from senescent erythrocytes, HRG1 proteins may help recover heme from phagolysosomes . This process is particularly important during hemolytic events that can cause oxidative stress. Examining HRG1-B function in this context could reveal mechanisms for maintaining redox balance during increased heme turnover.

  • Metabolic Reprogramming: Heme is a prosthetic group for proteins involved in cellular respiration and metabolism . Under stress conditions, HRG1-B might facilitate metabolic reprogramming by redistributing heme to support altered metabolic requirements. Studies could investigate whether HRG1-B contributes to metabolic adaptation during hypoxia or oxidative stress.

Understanding these relationships could provide insights into fundamental cellular stress responses and potentially identify new therapeutic approaches for conditions characterized by hypoxia or oxidative stress, such as ischemic injuries, neurodegenerative diseases, and cancer.

What are the major unresolved questions regarding Xenopus laevis HRG1-B that warrant further research?

Despite significant advances in understanding HRG1 proteins, several critical questions about Xenopus laevis HRG1-B remain unresolved:

  • Structural Determinants of Heme Transport: While key residues like H90 in TMD2 and the FARKY motif have been implicated in heme binding , the precise structural basis for heme recognition and transport remains poorly understood. High-resolution structural studies of HRG1-B could reveal the transport mechanism and facilitate structure-based drug design.

  • Regulatory Mechanisms: The factors controlling HRG1-B expression, trafficking, and activity beyond heme concentration are largely unknown. Identifying transcription factors, post-translational modifications, and interacting proteins that regulate HRG1-B would provide a more comprehensive understanding of heme homeostasis regulation.

  • Directional Transport Properties: Whether HRG1-B functions primarily as an importer, exporter, or bidirectional transporter of heme in different cellular contexts remains to be fully elucidated. Clarifying its directional transport properties and how they may be regulated is essential for understanding its physiological roles.

  • Developmental Dynamics: While studies in zebrafish have shown that HRG1 deficiency affects erythropoiesis and development , the specific developmental roles of Xenopus HRG1-B have not been fully characterized. Understanding its expression patterns and functions throughout Xenopus development could provide insights into vertebrate heme utilization during embryogenesis.

  • Comparative Functions of Paralogs: The functional relationship between Xenopus HRG1-B and other potential paralogs in the Xenopus genome requires further investigation to understand potential redundancy or specialization of function.

  • Integration with Other Heme Trafficking Pathways: How HRG1-B coordinates with other known or yet-to-be-discovered heme transporters and chaperones to maintain heme homeostasis represents a significant knowledge gap.

  • Roles in Disease Resistance: Whether HRG1-B plays roles in immunity or resistance to pathogens, particularly those that compete with the host for heme, remains an open question with potential implications for understanding host-pathogen interactions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.