Recombinant Xenopus laevis Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 2 protein (herpud2)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Xenopus laevis Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 2 protein (Herpud2) is a protein involved in the endoplasmic reticulum-associated degradation (ERAD) pathway . Herpud2 is a member of the HERPUD family . It is associated with the unfolded protein response (UPR) . The UPR is activated when unfolded or misfolded proteins accumulate in the endoplasmic reticulum (ER) .

Gene Information

The gene symbol for Herpud2 is herpud2 . It is also known as HERPUD family member 2 . herpud2 is orthologous to the human HERPUD2 gene (HERPUD family member 2) . Human HERPUD2 has the Ensembl gene ID ENSG00000122557 .

Protein Function

Herpud2 is a membrane-associated ER protein involved in stress response . It may also participate in the unfolded protein response (UPR) pathway . Herpud2 is an integral component of the HRD1 complex, facilitating retrotranslocation by recruiting DERL2 to HRD1 . HERP1 and HERP2 are essential adaptors between HRD1 and DERL2 that help organize a functional retrotranslocation complex in HRD1-mediated ERAD .

Homology and Structure

HERP2 shares 38% sequence identity and 51% homology with HERP1 . Similar to HERP1, it contains a ubiquitin-like (UBL) domain at the N terminus and a long hydrophobic segment close to the C-terminal region . Both N and C termini are exposed to the cytosol .

Role in ERAD

HERP1 and HERP2 are required for efficient degradation of both glycosylated and non-glycosylated SHH proteins as well as NHK . HERP regulates Hrd1-mediated ubiquitylation in a ubiquitin-like domain-dependent manner .

HERPUD2 in Humans

In humans, HERPUD2 is located predominantly on the ER, with both N and C termini in the cytosol . There are 7 transcripts (splice variants), 266 orthologues and 1 paralogue of the human HERPUD2 gene .

Expression

HERP2 is constitutively expressed in cells, whereas HERP1 is highly induced by ER stress . Elevation of Herp steady state levels is accompanied by an enhanced association of Herp with pre-existing Hrd1 .

Interactions

HERP1 and HERP2 interact with HRD1 through a region located in the cytosol . HERP1 and HERP2 are part of the HRD1-SEL1L-DERL2 complex .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance, incurring additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
herpud2; Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 2 protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-398
Protein Length
full length protein
Species
Xenopus laevis (African clawed frog)
Target Names
herpud2
Target Protein Sequence
MTCQPVMDCPVTLVIKAPNQKYDDQTINCFLDWTVEKLKSHLSKVYPSKPSAKDQRLVYS GKLLLDHLLLKDVLRKQDEYHMVHLVCASRTPPSSPKASKSSKSMGTSSSGRSSSSGSAN PGSTSQDTSSTYPDPRPGESIRHRHTPLMYNNLVHSHPYSYLRQEYALNPPPGQEAPSIF PAYSAFTPLQMMWWQQLYARQYYIYSQATASNQSTSNGENAQPVPRPVTNSENPPPNPPR APPNVAPEINPNIQMNAQGGPVMNEEDINRDWLDWIYTVSRAAILLSIVYFYSSFSRFVM VMGALILVYMHQAGWFPLLQDEGQQHPGDNAAEVNPDLVNNNDPQELERRMDDGLQEVHN NDAGVNVVARQGVLASAWSFITTFFTSLIPEGPPQGVN
Uniprot No.

Target Background

Function
Potentially involved in the unfolded protein response (UPR) pathway.
Database Links

KEGG: xla:379247

UniGene: Xl.5332

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is Xenopus laevis HERPUD2 and what is its functional significance in cellular processes?

HERPUD2 (Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 2 protein) is a homolog of HERPUD1 that functions as an integral component of the endoplasmic reticulum-associated degradation (ERAD) machinery. In Xenopus laevis, as in mammalian systems, HERPUD2 is predominantly localized to the ER membrane where it participates in protein quality control mechanisms .

The protein contains a ubiquitin-like (UBL) domain at its N-terminus and a hydrophobic segment near its C-terminal region, with both termini exposed to the cytosol . Functionally, HERPUD2 appears to serve as an essential adaptor between the E3 ubiquitin ligase HRD1 and the retrotranslocation channel component DERL2, facilitating the organization of a functional retrotranslocation complex in HRD1-mediated ERAD .

Research has demonstrated that HERPUD2 shows partial functional redundancy with HERPUD1, as both proteins contribute to the degradation of misfolded proteins in the ER. While individual depletion of either protein may show limited effects on ERAD substrates, simultaneous depletion significantly impairs the degradation of model ERAD substrates like SHH-C (Sonic Hedgehog C-terminal fragment) and NHK (Null Hong Kong α1-antitrypsin) .

How conserved is HERPUD2 between Xenopus laevis and humans?

While specific sequence conservation data between Xenopus laevis HERPUD2 and human HERPUD2 is not explicitly stated in the provided sources, we can infer significant conservation based on functional studies. The human HERPUD2 shares 38% sequence identity and 51% homology with human HERPUD1 . The functional conservation of ERAD machinery across vertebrates suggests that Xenopus HERPUD2 likely shares substantial sequence and structural similarity with its human counterpart.

This conservation is particularly relevant when using Xenopus as a model organism for studying human genetic disorders involving ER quality control and ERAD pathways. The evolutionary conservation of these pathways makes Xenopus an excellent system for investigating the fundamental mechanisms of protein quality control that may be disrupted in human diseases .

What is the subcellular localization and membrane topology of HERPUD2?

HERPUD2 is predominantly localized to the endoplasmic reticulum (ER), as demonstrated by immunostaining experiments showing co-localization with the ER marker Sec61α-RFP . Cell fractionation studies have confirmed that HERPUD2 is exclusively present in the membrane fraction, indicating it is a membrane-bound protein rather than a soluble one .

Regarding its membrane topology, HERPUD2 adopts a configuration where both its N- and C-termini are exposed to the cytosol. This was elegantly demonstrated through protease protection assays using FLAG-tagged N-terminus and HA-tagged C-terminus versions of HERPUD2. When membrane fractions containing tagged HERPUD2 were treated with proteinase K, both epitope tags became undetectable, indicating both termini were accessible to the protease on the cytosolic side of the ER membrane .

This topology is significant as it positions HERPUD2's functional domains (particularly the UBL domain) in the cytosol where they can interact with cytosolic components of the ubiquitin-proteasome system, while maintaining the protein's integration in the ER membrane where ERAD substrates are processed.

What are the key structural domains of HERPUD2 and their functional relevance?

HERPUD2 contains several important structural domains that contribute to its function in ERAD:

  • Ubiquitin-like (UBL) domain: Located at the N-terminus, this domain shares structural similarity with ubiquitin and likely mediates interactions with other components of the ERAD machinery, particularly those containing ubiquitin-binding domains .

  • Hydrophobic segment: Located near the C-terminal region, this segment anchors HERPUD2 to the ER membrane. The hydrophobic nature of this region is crucial for the protein's membrane integration .

  • Cytosolic terminal regions: Both the N- and C-termini of HERPUD2 are positioned on the cytosolic side of the ER membrane, allowing for interactions with cytosolic components of the ubiquitin-proteasome system and other ERAD factors .

The specific arrangement of these domains enables HERPUD2 to function as an adaptor protein in the HRD1 complex, facilitating the recruitment of DERL2 to HRD1 and thereby establishing a functional retrotranslocation complex for ERAD substrates .

What are the most effective methods for expressing and purifying recombinant Xenopus laevis HERPUD2?

For successful expression and purification of recombinant Xenopus laevis HERPUD2, researchers should consider the following methodological approach:

Expression Systems:

  • Bacterial expression: While economical, bacterial systems may not provide proper folding and post-translational modifications for membrane proteins like HERPUD2.

  • Insect cell expression: Baculovirus-infected Sf9 or High Five cells offer improved folding and modification capabilities for complex eukaryotic proteins.

  • Mammalian cell expression: HEK293 or CHO cells provide the most native-like environment for proper folding and modification, though at higher cost and lower yield.

Purification Strategy:

  • Affinity tags: Incorporate His6, FLAG, or GST tags at either terminus (preferably the N-terminus based on HERPUD2's topology).

  • Membrane protein extraction: Use mild detergents such as DDM (n-dodecyl β-D-maltoside) or LMNG (lauryl maltose neopentyl glycol) to solubilize HERPUD2 from membranes.

  • Chromatography steps: Employ sequential purification including affinity chromatography, ion exchange, and size exclusion chromatography for highest purity.

Quality Control:

  • Western blotting: Confirm identity using specific antibodies against HERPUD2 or epitope tags.

  • Mass spectrometry: Verify protein integrity and post-translational modifications.

  • Functional assays: Test interaction with known binding partners (HRD1, DERL2) to confirm proper folding.

When designing expression constructs, researchers should consider that both N- and C-termini of HERPUD2 are exposed to the cytosol in its native state, making either terminus potentially accessible for tagging without disrupting membrane topology .

How can CRISPR/Cas9 be effectively designed and implemented to study HERPUD2 function in Xenopus laevis?

CRISPR/Cas9 technology can be effectively employed to study HERPUD2 function in Xenopus laevis by following these guidelines:

sgRNA Design:

  • Target selection: Design multiple sgRNAs targeting conserved exons, preferably early in the coding sequence or targeting functional domains like the UBL domain.

  • Specificity verification: Check for off-target effects using algorithms specific for Xenopus laevis genome.

  • Efficiency prediction: Use scoring algorithms to predict sgRNA efficiency in Xenopus.

The Broad Institute has designed gRNAs for HERPUD2 that may serve as starting points .

Delivery Methods:

  • Microinjection: Deliver Cas9 protein (or mRNA) and sgRNA directly into fertilized Xenopus eggs at the one-cell stage for systemic knockout.

  • Targeted injection: For tissue-specific effects, inject into specific blastomeres at 2-8 cell stages.

Validation and Controls:

  • Multiple sgRNAs: Always use more than one sgRNA targeting different regions of HERPUD2 to confirm phenotype specificity.

  • T7 endonuclease assay: Verify genome editing efficiency.

  • Sequencing validation: Confirm mutations at the target site.

  • Rescue experiments: Co-inject with HERPUD2 mRNA resistant to CRISPR targeting to verify phenotype specificity .

Analysis Methods:

  • Phenotypic assessment: Examine developmental defects, particularly in tissues where ERAD plays crucial roles.

  • Molecular analysis: Assess changes in expression of ERAD components and accumulation of ERAD substrates.

  • Functional redundancy: Compare with HERPUD1 knockout and create double knockouts to assess functional overlap .

While designing CRISPR experiments in Xenopus, researchers must account for its allotetraploid genome (X. laevis) which may require targeting multiple gene copies for complete knockout .

What experimental approaches can be used to study HERPUD2 interaction with the ERAD machinery in Xenopus laevis?

To investigate HERPUD2 interactions with ERAD components in Xenopus laevis, researchers can employ several complementary approaches:

Co-immunoprecipitation (Co-IP):

  • Generate antibodies against Xenopus HERPUD2 or use epitope-tagged versions.

  • Immunoprecipitate HERPUD2 from Xenopus cell or embryo lysates and analyze co-precipitating proteins by immunoblotting or mass spectrometry.

  • Perform reverse Co-IP with antibodies against known ERAD components like HRD1, SEL1L, and DERL2.

In mammalian systems, immunoprecipitation with HRD1 antibodies co-precipitated both HERP1 and HERP2, indicating they form a complex with HRD1-SEL1L-DERL2 .

Proximity Labeling:

  • Express BioID or TurboID fusions of HERPUD2 in Xenopus embryos or cells.

  • Identify proteins in proximity to HERPUD2 through streptavidin pulldown of biotinylated proteins followed by mass spectrometry.

Crosslinking Mass Spectrometry:

  • Use chemical crosslinkers to capture transient protein interactions.

  • Identify crosslinked peptides to map specific interaction interfaces between HERPUD2 and ERAD components.

Fluorescence Microscopy:

  • Perform immunofluorescence to visualize co-localization of HERPUD2 with other ERAD components.

  • Use techniques like FRET or BiFC to verify direct protein-protein interactions in situ.

Functional Assays:

  • Assess ERAD substrate degradation kinetics using cycloheximide chase experiments in control versus HERPUD2-depleted conditions.

  • Compare the effects of single depletion (HERPUD2 only) versus double depletion (HERPUD1 and HERPUD2) on ERAD substrate stability .

These approaches should be complemented with careful controls, including verification of antibody specificity and comparison with mammalian ERAD systems to identify conserved interaction networks.

How can Xenopus embryos be used to assess the developmental effects of HERPUD2 disruption?

Xenopus embryos provide an excellent system for studying the developmental consequences of HERPUD2 disruption through the following methods:

Gene Knockdown/Knockout Approaches:

  • Morpholino oligonucleotides (MOs): Design translation-blocking or splice-blocking MOs against HERPUD2 and inject into fertilized eggs.

  • CRISPR/Cas9: As detailed previously, target HERPUD2 using CRISPR/Cas9 for gene knockout.

  • Dominant negative constructs: Express truncated versions of HERPUD2 that may interfere with native protein function.

Developmental Analysis Techniques:

  • Whole-mount in situ hybridization: Assess changes in expression patterns of developmental markers in HERPUD2-depleted embryos .

  • Immunohistochemistry: Visualize protein distribution and tissue architecture using specific antibodies .

  • Time-lapse imaging: Track developmental processes in real-time to identify specific disruptions.

Tissue-Specific Assessments:

  • Neural crest cell analysis: Examine NCC migration using markers like xTWIST and quantify pharyngeal arch development (length and area measurements) .

  • Heart development: Use markers like anti-tropomyosin antibodies to assess cardiac morphology .

  • Kidney development: Employ specific markers to evaluate pronephros development .

Functional Recovery:

  • Rescue experiments: Co-inject HERPUD2 mRNA resistant to knockdown/knockout to verify specificity of developmental phenotypes.

  • HERPUD1 compensation: Test whether HERPUD1 overexpression can rescue HERPUD2 loss, given their partial functional redundancy .

Quantitative Assessments:

  • Morphometric analysis: Measure specific anatomical features like head size, eye diameter, or organ dimensions.

  • Developmental timing: Assess whether HERPUD2 disruption causes developmental delays.

  • Survival rates: Quantify embryonic lethality at different developmental stages.

The advantages of using Xenopus for these studies include the ability to obtain large numbers of synchronously developing embryos, external development allowing easy observation, and the capacity to target specific tissues through directed microinjection .

What is the relationship between HERPUD2 and HERPUD1 in Xenopus laevis, and how does their functional redundancy compare to mammalian systems?

Research on HERPUD proteins reveals a complex relationship between HERPUD1 and HERPUD2 in terms of structure, function, and redundancy:

Structural Comparison:
In human cells, HERPUD2 shares 38% sequence identity and 51% homology with HERPUD1 . Both proteins contain a ubiquitin-like (UBL) domain at the N-terminus and a hydrophobic segment near the C-terminal region, suggesting evolutionary conservation of these functional domains. Both adopt similar membrane topologies with N- and C-termini facing the cytosol .

Functional Redundancy Data:
Studies using ERAD substrates reveal the following functional relationship between HERPUD1 and HERPUD2:

ERAD SubstrateHERPUD1 DepletionHERPUD2 DepletionDouble Depletion
SHH-CMinor inhibitionNo significant effectStrong stabilization
SHH-N278ANo significant effectNo significant effectStrong inhibition
NHKMinor effectMinor effectSignificant inhibition

This data demonstrates that while individual depletion of either HERPUD protein has limited impact on ERAD substrate degradation, simultaneous depletion dramatically impairs the ERAD pathway . This suggests that HERPUD1 and HERPUD2 have partially redundant functions, with HERPUD1 potentially contributing slightly more to ERAD of certain substrates (like SHH-C) in unstressed conditions.

Comparative Analysis with Mammalian Systems:
The functional redundancy observed between HERPUD proteins appears to be conserved between Xenopus and mammalian systems. In both cases, they serve as adaptors in the HRD1 complex, facilitating the recruitment of DERL2 to establish a functional retrotranslocation complex . This conservation makes Xenopus an excellent model for studying these proteins in the context of human disease.

Evolutionary Implications:
The partial redundancy between HERPUD1 and HERPUD2 suggests an evolutionary strategy to ensure robustness in the critical ERAD pathway. This redundancy may allow for specialized functions to evolve while maintaining essential quality control mechanisms in the ER.

How can Xenopus laevis HERPUD2 studies inform our understanding of human disease mechanisms?

Xenopus laevis provides a powerful model system for investigating how HERPUD2 dysfunction may contribute to human diseases through several research approaches:

Developmental Disorders:
HERPUD2's role in ERAD suggests it may impact developmental processes where protein quality control is crucial. Xenopus embryos allow researchers to observe the consequences of HERPUD2 disruption on developmental processes in real-time, potentially informing our understanding of developmental disorders with ER stress components .

Neurodegenerative Diseases:
Many neurodegenerative disorders involve impaired protein quality control and ER stress. Xenopus models with manipulated HERPUD2 expression can reveal how alterations in ERAD efficiency affect neuronal development and function, potentially revealing mechanisms relevant to conditions like Alzheimer's, Parkinson's, or prion diseases.

Modeling Specific Human Mutations:
Human HERPUD2 variants identified in disease cohorts can be introduced into Xenopus through targeted genome editing or mRNA expression to assess their functional consequences in a vertebrate model. This approach can help distinguish pathogenic variants from benign polymorphisms.

Therapeutic Target Validation:
Xenopus provides an efficient system for testing potential therapeutic strategies targeting the ERAD pathway. Compounds designed to modulate HERPUD2 function can be evaluated for their effects on development and ERAD substrate clearance.

Disease-Relevant Assays:
Specific aspects of HERPUD2 function can be assessed in Xenopus using disease-relevant readouts:

  • ER stress response: Measure changes in UPR markers following HERPUD2 manipulation.

  • Protein aggregation: Assess the accumulation of disease-associated proteins when HERPUD2 function is compromised.

  • Cell death pathways: Determine if HERPUD2 dysfunction triggers apoptotic or other cell death mechanisms.

The genetic manipulability, rapid development, and cost-effectiveness of Xenopus make it particularly valuable for these translational studies, bridging the gap between cellular models and mammalian disease models .

What technical challenges exist in studying HERPUD2 protein-protein interactions in Xenopus laevis, and how can they be overcome?

Investigating HERPUD2 protein interactions in Xenopus laevis presents several technical challenges along with potential solutions:

Challenge 1: Limited Xenopus-specific antibodies

  • Solution: Generate custom antibodies against Xenopus HERPUD2 or use epitope-tagged versions (FLAG, HA, etc.) for which commercial antibodies are readily available. Validation of antibody specificity is crucial, particularly ensuring no cross-reactivity with HERPUD1 .

  • Alternative approach: Use proximity labeling techniques like BioID that don't rely on specific antibodies.

Challenge 2: Membrane protein solubilization

  • Solution: Optimize detergent conditions specifically for Xenopus ER membranes. Test a panel of detergents (digitonin, DDM, CHAPS) at various concentrations to maintain native protein interactions while effectively solubilizing HERPUD2.

  • Technical consideration: Different detergents may reveal different interaction partners, so multiple conditions should be tested.

Challenge 3: Distinguishing genuine from artifactual interactions

  • Solution: Implement stringent controls including:

    • Reverse co-immunoprecipitations

    • Competition with excess untagged protein

    • Comparison with interactions in mammalian systems

    • Validation through multiple independent techniques

Challenge 4: Developmental stage-specific interactions

  • Solution: Perform interaction studies across multiple developmental stages to capture dynamic changes in HERPUD2 interaction networks.

  • Approach: Generate stage-specific interactomes using quantitative proteomics to reveal temporal regulation of HERPUD2 complexes.

Challenge 5: Distinguishing between HERPUD1 and HERPUD2 specific interactions

  • Solution: Perform parallel interaction studies with both proteins and implement differential proteomics to identify unique versus shared interaction partners.

  • Consideration: Create chimeric proteins exchanging domains between HERPUD1 and HERPUD2 to map domain-specific interactions.

Challenge 6: Visualization of interactions in intact embryos

  • Solution: Develop split fluorescent protein complementation assays (BiFC) optimized for Xenopus to visualize interactions in living embryos.

  • Advanced approach: Combine with tissue-specific promoters to examine interactions in relevant developmental contexts.

By addressing these challenges with appropriate technical solutions, researchers can successfully investigate the HERPUD2 interactome in Xenopus laevis and gain insights into its functions in ERAD and development.

How can high-throughput approaches be applied to study HERPUD2 function in Xenopus laevis?

High-throughput approaches offer powerful tools for comprehensively investigating HERPUD2 function in Xenopus laevis:

CRISPR-Based Screens:

  • Multiplexed sgRNA libraries: Design sgRNA libraries targeting various regions of HERPUD2 and other ERAD components to identify functional domains and genetic interactions.

  • Phenotypic screening: Develop quantifiable readouts (e.g., fluorescent reporters of ER stress) to rapidly assess the impact of different CRISPR-induced mutations.

  • Implementation: Inject sgRNA pools into Xenopus eggs, raise embryos, and sequence to correlate specific mutations with observed phenotypes.

Transcriptomic Approaches:

  • RNA-seq analysis: Compare gene expression profiles between wild-type and HERPUD2-depleted embryos at multiple developmental stages.

  • Single-cell RNA-seq: Characterize cell-type-specific responses to HERPUD2 manipulation, particularly in tissues with high secretory loads.

  • Ribosome profiling: Assess changes in translation efficiency of specific mRNAs when HERPUD2 function is compromised.

Proteomic Methods:

  • Quantitative proteomics: Use SILAC or TMT labeling to identify proteins differentially expressed or modified in HERPUD2-deficient embryos.

  • Degradomics: Apply methods to specifically capture and identify ERAD substrates whose degradation depends on HERPUD2.

  • Interactomics: Perform systematized pull-downs with tagged HERPUD2 across different developmental stages to map dynamic interaction networks.

High-Content Imaging:

  • Automated phenotyping: Develop image analysis pipelines to quantify morphological changes in HERPUD2-depleted embryos.

  • Live imaging arrays: Monitor multiple embryos simultaneously to track developmental consequences of HERPUD2 manipulation.

  • Reporter systems: Generate transgenic lines with fluorescent indicators of ER stress or ERAD activity for real-time monitoring.

Small Molecule Screening:

  • ERAD modulators: Test libraries of compounds for their ability to rescue or phenocopy HERPUD2 depletion phenotypes.

  • Target validation: Use chemical genetic approaches to identify specific molecular pathways downstream of HERPUD2.

Data Integration Platforms:

  • Multi-omics integration: Combine genomic, transcriptomic, and proteomic datasets to build comprehensive models of HERPUD2 function.

  • Network analysis: Apply graph theory and machine learning to identify central nodes and pathways connected to HERPUD2.

The implementation of these high-throughput approaches in Xenopus offers significant advantages, including the ability to rapidly screen large numbers of embryos, the accessibility of embryos for imaging and manipulation, and the evolutionary conservation of ERAD pathways between Xenopus and humans .

What are the best practices for designing knockdown and rescue experiments for HERPUD2 in Xenopus laevis?

Successful knockdown and rescue experiments for HERPUD2 in Xenopus laevis require careful design and execution:

Knockdown Strategy Design:

  • Morpholino (MO) approach:

    • Design translation-blocking MOs targeting the start codon region of HERPUD2 mRNA

    • Design splice-blocking MOs targeting exon-intron boundaries to disrupt splicing

    • Test multiple MOs to confirm specificity of phenotypes

    • Include control MOs (standard control or mismatch control) in all experiments

  • CRISPR/Cas9 approach:

    • Design at least 2-3 different sgRNAs targeting early exons

    • Validate editing efficiency using T7 endonuclease assay or direct sequencing

    • Consider the allotetraploid nature of X. laevis when designing targeting strategies

Critical Controls:

  • Dose dependency: Test a range of MO or sgRNA concentrations to establish dose-response relationships

  • Specificity controls: Use mismatch MOs or non-targeting sgRNAs

  • Phenotype documentation: Thoroughly document all observed phenotypes with quantitative metrics

Rescue Experiment Design:

  • Construct preparation:

    • Generate rescue constructs expressing HERPUD2 mRNA resistant to MO binding or CRISPR targeting

    • For MO resistance, introduce silent mutations in the MO binding site

    • For CRISPR resistance, modify the PAM site or sgRNA target sequence

    • Include appropriate tags (e.g., HA, FLAG) to verify expression

  • Co-injection protocol:

    • Inject knockdown reagent (MO or Cas9/sgRNA) and rescue mRNA simultaneously

    • Test multiple ratios of knockdown:rescue reagents

    • Include rescue-only controls to assess potential overexpression effects

Validation Approaches:

  • Protein level verification: Confirm knockdown and rescue at the protein level via Western blot

  • Functional assays: Assess ERAD efficiency using model substrates like SHH-C or NHK

  • Phenotypic rescue scoring: Establish quantitative scoring systems for developmental phenotypes

Addressing Redundancy:
Since HERPUD1 and HERPUD2 show functional redundancy , consider:

  • Dual knockdown: Simultaneously target both HERPUD1 and HERPUD2

  • Cross-rescue: Test whether HERPUD1 overexpression can rescue HERPUD2 knockdown and vice versa

  • Domain swapping: Create chimeric constructs to identify which domains determine functional specificity

These approaches will help establish the specific functions of HERPUD2 in Xenopus development while controlling for potential off-target effects and compensatory mechanisms.

How can researchers optimize immunodetection methods for Xenopus laevis HERPUD2 protein?

Successful immunodetection of Xenopus laevis HERPUD2 requires careful optimization of protocols for various applications:

Western Blotting Optimization:

  • Sample preparation:

    • For membrane proteins like HERPUD2, use specialized lysis buffers containing appropriate detergents (1% Triton X-100, DDM, or CHAPS)

    • Include protease inhibitors to prevent degradation

    • Consider membrane enrichment protocols to increase HERPUD2 concentration

  • Gel electrophoresis considerations:

    • Use gradient gels (4-15%) for optimal resolution

    • For membrane proteins, avoid excessive heating of samples (37°C instead of 95°C)

    • Load positive controls (e.g., tagged recombinant HERPUD2)

  • Transfer optimization:

    • For membrane proteins, semi-dry transfer with specialized buffers may improve efficiency

    • Extend transfer times for complete transfer of membrane proteins

  • Antibody selection and validation:

    • Test cross-reactivity of mammalian HERPUD2 antibodies with Xenopus protein

    • Generate Xenopus-specific antibodies if needed

    • Validate specificity using HERPUD2-depleted samples as negative controls

    • Verify lack of cross-reactivity with HERPUD1

Immunohistochemistry/Immunofluorescence Protocol:

  • Fixation optimization:

    • Test multiple fixatives: 4% paraformaldehyde (for structural preservation) vs. methanol (for some antigens)

    • Optimize fixation duration (typically 5-20 minutes) to balance preservation and antigen accessibility

  • Permeabilization conditions:

    • For membrane proteins, gentle permeabilization (0.1% Triton X-100 for 20 minutes) is often effective

    • Test alternative detergents (saponin, digitonin) if standard approaches fail

  • Antigen retrieval:

    • If needed, test heat-induced (citrate buffer) or enzymatic antigen retrieval methods

    • Optimize duration and temperature for Xenopus tissues

  • Signal amplification:

    • Consider tyramide signal amplification for low-abundance proteins

    • Use secondary antibodies with bright, photostable fluorophores

    • Employ confocal microscopy for optimal subcellular localization

Immunoprecipitation Considerations:

  • Lysis conditions:

    • Use mild detergents that preserve protein-protein interactions

    • Test digitonin (0.5-1%) which often preserves membrane protein complexes

  • Pre-clearing strategy:

    • Implement thorough pre-clearing to reduce background

    • Use species-matched IgG controls

  • Antibody coupling:

    • Consider covalent coupling to beads to eliminate antibody bands in the eluate

    • Optimize antibody concentration for maximum capture efficiency

Epitope Tagging Strategy:
When direct detection is challenging:

  • Tag selection: FLAG, HA, or V5 tags often work well and have excellent commercial antibodies

  • Tag position: Based on HERPUD2 topology, N-terminal tagging may be preferable as both N and C termini face the cytosol

  • Expression level control: Use inducible or weak promoters to avoid overexpression artifacts

These optimized protocols will facilitate reliable detection of HERPUD2 in Xenopus laevis, enabling more detailed studies of its expression, localization, and interactions.

What experimental approaches can reveal the role of HERPUD2 in developmental processes unique to Xenopus laevis?

Xenopus laevis offers unique advantages for studying HERPUD2's role in development through several specialized experimental approaches:

Neural Crest Cell (NCC) Migration Assays:

  • In vivo NCC tracking:

    • Perform whole-mount in situ hybridization using NCC markers like xTWIST

    • Quantify pharyngeal arch length and area in control vs. HERPUD2-depleted embryos

    • Use ImageJ for standardized measurements (from dorsal to ventral points of each arch)

  • Ex vivo NCC explant cultures:

    • Dissect NCCs from stage 16 embryos and culture on fibronectin-coated coverslips

    • Use time-lapse confocal microscopy to measure migration parameters (velocity, dispersion)

    • Perform chemotaxis assays using SDF-1 coated beads to assess directional migration

Organ-Specific Developmental Analysis:

  • Heart development assessment:

    • Visualize cardiac morphology using anti-tropomyosin (Tmy) antibody staining

    • Employ scanning electron microscopy (SEM) for detailed structural analysis

    • Use optical coherence tomography (OCT) to detect improperly looped hearts or chamber formation defects

  • Kidney development studies:

    • Apply in vitro explant and transplant techniques

    • Perform electrophysiological recordings to assess functional development

    • Use optogenetic manipulations to alter physiological parameters (calcium, pH) in developing pronephros

Tissue-Specific HERPUD2 Manipulation:

  • Targeted microinjection:

    • Inject HERPUD2 morpholinos or CRISPR components into specific blastomeres at 8-16 cell stage

    • Target precursors of tissues with high secretory load (e.g., pancreas, hatching gland)

    • Compare phenotypes between targeted and non-targeted tissues in the same embryo

  • Inducible knockdown/overexpression:

    • Develop transgenic lines with tissue-specific, heat-shock inducible HERPUD2 constructs

    • Activate at specific developmental stages to distinguish early vs. late requirements

ER Stress Response Assessment:

  • Unfolded protein response (UPR) reporters:

    • Generate transgenic Xenopus with fluorescent UPR pathway reporters

    • Monitor UPR activation in real-time during development when HERPUD2 is manipulated

  • ER morphology analysis:

    • Use transmission electron microscopy (TEM) to assess ER ultrastructure

    • Visualize ER-specific markers (calreticulin, calnexin) using immunofluorescence

Comparative Approaches:

  • HERPUD1 vs. HERPUD2 manipulation:

    • Compare developmental consequences of individual vs. combined depletion

    • Identify tissues where redundancy exists vs. those with protein-specific requirements

  • Cross-species rescue:

    • Test whether human HERPUD2 can rescue Xenopus HERPUD2 depletion

    • Identify evolutionarily conserved vs. species-specific functions

These approaches leverage the unique advantages of Xenopus as a developmental model, including external development, large embryo size, and tissue transparency, to reveal HERPUD2's specific roles in vertebrate development that may be difficult to study in other systems .

How do environmental stressors affect HERPUD2 expression and function in Xenopus laevis?

Environmental stressors can significantly impact HERPUD2 expression and function in Xenopus laevis, providing insights into stress response mechanisms:

ER Stress Inducers:

  • Tunicamycin: This N-glycosylation inhibitor can be used to experimentally induce ER stress in Xenopus embryos or cell cultures. Researchers can assess:

    • Changes in HERPUD2 mRNA and protein levels following treatment

    • Alterations in HERPUD2 subcellular localization

    • Modifications to HERPUD2 interaction partners under stress conditions

  • Thapsigargin: By depleting ER calcium stores, thapsigargin represents another method to induce ER stress:

    • Compare HERPUD1 vs. HERPUD2 induction kinetics and magnitude

    • Determine tissue-specific responses to ER calcium depletion

    • Assess whether HERPUD2 depletion sensitizes cells to thapsigargin-induced apoptosis

Temperature Stress:
Xenopus development is temperature-dependent, making it an excellent model for studying thermal stress:

  • Heat shock response:

    • Determine whether HERPUD2 is heat-shock inducible

    • Compare HERPUD2 induction between different developmental stages

    • Assess interaction between heat shock response and UPR pathways

  • Cold shock response:

    • Examine HERPUD2 regulation during hypothermic conditions

    • Investigate potential protective roles in cold adaptation

Oxidative Stress:

  • Hydrogen peroxide or arsenite treatment:

    • Determine if oxidative stress alters HERPUD2 expression or function

    • Assess whether HERPUD2 depletion increases sensitivity to oxidative damage

    • Investigate potential cross-talk between oxidative stress and ERAD pathways

Hypoxia Response:

  • Experimental hypoxia chambers:

    • Monitor HERPUD2 expression under low oxygen conditions

    • Assess the relationship between HIF-1α signaling and HERPUD2 function

    • Determine if HERPUD2 contributes to hypoxic adaptation

Environmental Toxicants:
Xenopus is used in environmental toxicology, allowing assessment of how toxicants affect HERPUD2:

  • Heavy metals:

    • Test whether cadmium, mercury, or lead exposure alters HERPUD2 expression

    • Determine if HERPUD2 contributes to heavy metal detoxification

  • Endocrine disruptors:

    • Investigate whether compounds like BPA affect HERPUD2 regulation

    • Assess potential connections between endocrine and ER stress pathways

Methodological Approaches:

  • qRT-PCR arrays: Profile expression changes of HERPUD2 alongside other stress-responsive genes

  • Stress-responsive promoter analysis: Identify regulatory elements controlling HERPUD2 expression

  • ChIP-seq: Determine transcription factors binding to HERPUD2 regulatory regions under stress

  • Proteomics: Identify post-translational modifications of HERPUD2 induced by different stressors

These experiments can reveal how HERPUD2 functions as part of the cellular stress response network and provide insights into its role in developmental resilience under challenging environmental conditions.

What are the most promising future directions for Xenopus laevis HERPUD2 research?

Based on current understanding of HERPUD2 biology and the advantages of the Xenopus model system, several promising research directions emerge:

Comprehensive ERAD Substrate Profiling:
Developing proteomics approaches to identify the complete repertoire of ERAD substrates dependent on HERPUD2 in Xenopus would significantly advance our understanding of its biological functions. Comparing these substrate profiles between HERPUD1 and HERPUD2 knockouts would further clarify their functional specialization versus redundancy.

Developmental Tissue-Specific Requirements:
Systematically mapping HERPUD2 expression and function across developmental stages and tissues could reveal specialized roles in particular developmental contexts. Tissues with high secretory loads (e.g., hatching gland, cement gland) may be particularly sensitive to HERPUD2 disruption and warrant focused investigation.

Stress Response Integration:
Exploring how HERPUD2 functions integrate with broader stress response pathways (UPR, heat shock, oxidative stress) could reveal its role in developmental resilience. The external development of Xenopus makes it particularly well-suited for controlled environmental stress experiments.

Cross-Species Comparative Analysis:
Extending studies to compare HERPUD2 function between X. laevis, X. tropicalis, and mammalian systems would highlight evolutionarily conserved mechanisms. The recent sequencing of Xenopus genomes facilitates such comparative genomics approaches.

Therapeutic Target Validation:
Xenopus offers an efficient system for screening compounds that modulate ERAD function, potentially identifying therapeutic approaches for diseases involving ER stress. Small molecule screens using HERPUD2-related phenotypes as readouts could identify novel modulators of the ERAD pathway.

Advanced Imaging Applications:
Developing methods for live imaging of HERPUD2 dynamics during development and in response to stressors would provide unprecedented insights into its function. New techniques like light-sheet microscopy combined with tissue clearing methods could enable whole-embryo visualization of HERPUD2 activity.

Single-Cell Approaches:
Applying single-cell transcriptomics and proteomics to HERPUD2 studies would reveal cell-type-specific functions and potentially identify specialized roles in rare cell populations during development.

These research directions leverage the unique advantages of Xenopus while addressing fundamental questions about HERPUD2 biology that have relevance across vertebrate species, including potential connections to human disease mechanisms.

What are the implications of HERPUD2 research for understanding evolutionary conservation of ERAD mechanisms?

Research on HERPUD2 in Xenopus laevis provides valuable insights into the evolutionary conservation and specialization of ERAD mechanisms across species:

Functional Domain Conservation:
The structural similarity between Xenopus and mammalian HERPUD proteins, including the ubiquitin-like (UBL) domain and membrane-integration topology, suggests strong evolutionary pressure to maintain these features . This conservation likely reflects fundamental requirements for ERAD function across vertebrates. Comparative studies can identify which domains show the highest conservation, potentially highlighting functionally critical regions.

Evolutionary Adaptation of Redundancy:
The partial functional redundancy between HERPUD1 and HERPUD2 observed in mammals appears to be conserved in Xenopus . This suggests that gene duplication and subsequent specialization of HERP proteins occurred before the divergence of amphibians and mammals. This redundancy may represent an evolutionary strategy to ensure robustness of the essential ERAD pathway while allowing for gradual functional specialization.

Species-Specific Adaptations:
While core ERAD functions may be conserved, Xenopus-specific adaptations in HERPUD2 function might exist to accommodate unique developmental contexts (e.g., rapid external development, metamorphosis). Identifying these adaptations could reveal how ERAD mechanisms have been tailored to specific physiological demands across evolution.

ERAD Complex Assembly Conservation:
The finding that HERPUD proteins serve as adaptors between HRD1 and DERL2 in mammalian systems can be validated in Xenopus to determine if this architectural role in ERAD complex organization is evolutionarily conserved. Conservation of these interaction networks would suggest fundamental organizational principles of ERAD machinery across vertebrates.

Developmental Context Integration:
Examining how HERPUD2 function has been integrated into species-specific developmental programs could reveal evolutionary innovations in ERAD regulation. For instance, investigating whether HERPUD2 expression or function is regulated during Xenopus-specific developmental events like metamorphosis could uncover unique adaptations.

Comparative Stress Responses: Analyzing how HERPUD2 regulation responds to environmental stressors across species might reveal both conserved stress response mechanisms and species-specific adaptations related to different environmental niches.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.