Recombinant Xenopus laevis Hyaluronan synthase 1 (has1)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Xenopus laevis Hyaluronan Synthase 1 (Has1)

Recombinant Xenopus laevis Hyaluronan Synthase 1 (Has1), originally termed DG42, is a membrane-bound enzyme responsible for synthesizing hyaluronan (HA), a high-molecular-weight glycosaminoglycan critical for extracellular matrix structure and cellular processes. This enzyme is part of the vertebrate HAS gene family and shares homology with bacterial HA synthases like Streptococcus pyogenes HasA . Recombinant versions are produced for functional studies, enabling insights into HA biosynthesis mechanisms and therapeutic applications.

Gene Structure and Evolution

  • The Has1 gene in Xenopus laevis (xHas1) spans ~11 kb and contains 5 exons and 4 introns, similar to mammalian counterparts .

  • Evolutionary analysis suggests vertebrate HAS genes arose via sequential duplication, with xHas1 representing the ancestral form .

  • Key conserved residues (e.g., catalytic cysteines and serine motifs) are critical for HA chain elongation .

Protein Features

  • Size: 588 amino acids (predicted molecular weight ~66 kDa) .

  • Domains: Transmembrane helices (TMHs) form a pore for HA extrusion, while cytoplasmic domains bind UDP-sugar substrates (UDP-GlcA and UDP-GlcNAc) .

  • Activity: Produces high-molecular-weight HA (>1.6 MDa) in vitro, distinct from bacterial synthases like Chlorella virus HAS (CvHAS), which generates shorter polymers .

Catalytic Mechanism

  • Processivity: XlHas1 elongates HA by alternating β-1,3 and β-1,4 glycosidic linkages, extruding the polymer through a membrane channel .

  • Substrate Requirements: Requires high UDP-sugar concentrations (Km values: 370 µM for UDP-GlcA, 470 µM for UDP-GlcNAc) .

  • Key Residues:

    • W491 (gating loop): Mutation to alanine abolishes activity, while phenylalanine substitution reduces HA size .

    • C307 (switch loop): Stabilizes the HA chain during elongation .

Regulation

  • Induced by inflammatory cytokines (e.g., IL-1β) and growth factors (e.g., TGF-β) .

  • Unlike HAS2 and HAS3, HAS1 activity is minimally affected by phosphorylation or O-GlcNAcylation .

Available Recombinant Forms

Product CodeHostTagRegionSource
CSB-EP010139XBE1 E. coliVariablePartial (82–401 aa)Cusabio
RFL23710XF E. coliHisFull-lengthCreative BioMart

Applications in Research

  • HA Biosynthesis Studies: Used to dissect substrate specificity and polymer length regulation .

  • Disease Models: Overexpression in cancer cells correlates with HA-dependent tumor progression .

  • Structural Biology: Cryo-EM structures inform drug design targeting HA overproduction in fibrosis and cancer .

Challenges and Future Directions

  • Low Basal Activity: Requires high UDP-sugar concentrations for activation, limiting its study in standard cell cultures .

  • Therapeutic Potential: Modulating HA size via Has1 mutagenesis could address pathologies like osteoarthritis or tumor metastasis .

  • Unresolved Questions:

    • Role of splice variants in genetic instability .

    • Post-translational regulation in inflammatory contexts .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please specify them when placing your order. We will prepare the product according to your needs.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, storage temperature, and the protein's intrinsic stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
has1; Hyaluronan synthase 1; DG42 protein; Hyaluronate synthase 1; Hyaluronic acid synthase 1; HA synthase 1; xHAS1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-588
Protein Length
full length protein
Species
Xenopus laevis (African clawed frog)
Target Names
has1
Target Protein Sequence
MKEKAAETMEIPEGIPKDLEPKHPTLWRIIYYSFGVVLLATITAAYVAEFQVLKHEAILF SLGLYGLAMLLHLMMQSLFAFLEIRRVNKSELPCSFKKTVALTIAGYQENPEYLIKCLES CKYVKYPKDKLKIILVIDGNTEDDAYMMEMFKDVFHGEDVGTYVWKGNYHTVKKPEETNK GSCPEVSKPLNEDEGINMVEELVRNKRCVCIMQQWGGKREVMYTAFQAIGTSVDYVQVCD SDTKLDELATVEMVKVLESNDMYGAVGGDVRILNPYDSFISFMSSLRYWMAFNVERACQS YFDCVSCISGPLGMYRNNILQVFLEAWYRQKFLGTYCTLGDDRHLTNRVLSMGYRTKYTH KSRAFSETPSLYLRWLNQQTRWTKSYFREWLYNAQWWHKHHIWMTYESVVSFIFPFFITA TVIRLIYAGTIWNVVWLLLCIQIMSLFKSIYACWLRGNFIMLLMSLYSMLYMTGLLPSKY FALLTLNKTGWGTSGRKKIVGNYMPILPLSIWAAVLCGGVGYSIYMDCQNDWSTPEKQKE MYHLLYGCVGYVMYWVIMAVMYWVWVKRCCRKRSQTVTLVHDIPDMCV
Uniprot No.

Target Background

Function
Hyaluronan synthase 1 (HAS1) catalyzes the addition of GlcNAc or GlcUA monosaccharides to the nascent hyaluronan polymer. It plays a crucial role in hyaluronan synthesis, a major component of most extracellular matrices. Hyaluronan has a structural role in tissue architectures and regulates cell adhesion, migration, and differentiation. HAS1 can also catalyze the synthesis of chito-oligosaccharide depending on the substrate.
Database Links

KEGG: xla:379383

UniGene: Xl.4517

Protein Families
NodC/HAS family
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Expression moves as a gradient through the embryo. The mRNA is first expressed in the animal region of the blastula, and by early gastrula is found everywhere except in the outer layer of the dorsal blastopore lip. By mid-gastrula, protein is present in t

Q&A

What is Hyaluronan Synthase 1 and how does it differ in Xenopus laevis compared to other species?

Hyaluronan synthase 1 (Has1) is an integral membrane protein that synthesizes hyaluronan, an essential glycosaminoglycan in the extracellular matrix. In Xenopus laevis, Has1 exhibits notable differences compared to mammalian versions. Unlike human and mouse enzymes that add precursor sugars to the reducing end of the growing polymer, Xenopus laevis Has utilizes the non-reducing end for synthesis, similar to bacterial hyaluronan synthases like those found in Pasteurella multocida . This fundamental difference in directionality suggests distinct evolutionary adaptations in amphibian Has enzymes that may influence experimental design when working with recombinant proteins.

What are the substrate requirements for Xenopus laevis Has1 activity?

Xenopus laevis Has1, like other hyaluronan synthases, requires specific substrates for enzymatic activity. These include the UDP-sugar precursors UDP-glucuronic acid (UDP-GlcUA) and UDP-N-acetylglucosamine (UDP-GlcNAc), which serve as building blocks for hyaluronan synthesis . Additionally, Has1 requires divalent cations such as Mg²⁺ or Mn²⁺ for activity. Notably, Has1 generally requires higher concentrations of these sugar precursors for activation compared to other Has isoforms, which has significant implications for experimental design when working with the recombinant enzyme. Researchers should ensure adequate substrate concentrations in assay conditions to achieve measurable activity.

What expression systems are optimal for producing functional recombinant Xenopus laevis Has1?

When expressing recombinant Xenopus laevis Has1, mammalian expression systems are generally preferred over bacterial systems due to the integral membrane nature of the protein and requirements for post-translational modifications. Based on approaches used for similar proteins, Chinese hamster ovary (CHO) cells have proven effective for hyaluronan synthase expression . These cells provide the appropriate membrane environment and post-translational machinery necessary for producing functional Has1. Alternative systems like human embryonic kidney (HEK293) cells may also be suitable. When designing expression constructs, researchers should include appropriate secretion signals and consider epitope tags that don't interfere with the catalytic domains of the enzyme.

What purification strategies yield highest activity for recombinant Xenopus laevis Has1?

Purifying recombinant Xenopus laevis Has1 presents challenges due to its transmembrane nature. Effective strategies typically involve:

  • Detergent solubilization: Mild detergents like digitonin or DDM (n-Dodecyl β-D-maltoside) help extract Has1 from membranes while preserving activity

  • Affinity chromatography: Using epitope tags (His, FLAG) for selective binding

  • Size exclusion chromatography: For removing aggregates and obtaining homogeneous protein

The most critical consideration is maintaining the native conformation of Has1 throughout purification. Temperature, pH, and buffer composition significantly impact enzyme stability. Purification steps should be performed at 4°C, and buffers should contain glycerol (10-15%) and appropriate divalent cations (Mg²⁺ or Mn²⁺) to preserve enzymatic activity. Researchers should verify enzyme activity at each purification stage, as yield may need to be balanced against maintaining catalytic function.

How can I measure the enzymatic activity of recombinant Xenopus laevis Has1?

Several complementary approaches can be used to measure the enzymatic activity of recombinant Xenopus laevis Has1:

MethodPrincipleAdvantagesLimitations
Radiometric assayIncorporation of radiolabeled UDP-sugars into hyaluronanHigh sensitivity, quantitativeRequires radioactive materials, specialized equipment
Size exclusion chromatographySeparation and quantification of synthesized hyaluronanDetermines molecular weight distributionTime-consuming, lower sensitivity
Enzyme-linked sorbent assayDetection using hyaluronan-binding proteinsMedium-high throughput, non-radioactiveIndirect measurement
Mass spectrometryAnalysis of reaction productsDetailed structural informationComplex sample preparation, specialized equipment

When designing activity assays, it's important to remember that Xenopus laevis Has1 requires higher concentrations of UDP-sugar precursors compared to mammalian orthologs and operates at the non-reducing end of the growing hyaluronan chain . Optimal activity typically requires both UDP-GlcUA and UDP-GlcNAc at concentrations of 1-5 mM, along with divalent cations (Mg²⁺ or Mn²⁺) at 5-10 mM. Reaction conditions should be carefully optimized for pH (typically 7.0-7.5) and temperature (25-30°C for Xenopus enzymes).

How does Xenopus laevis Has1 activity compare to Has2 and Has3 in the same species?

While specific comparative data for all three Has isoforms in Xenopus laevis is not provided in the search results, insights can be drawn from mammalian studies. Generally, Has1 shows lower intrinsic activity compared to Has2 and Has3, requiring higher concentrations of sugar precursors for activation . This pattern likely holds true for Xenopus laevis Has isoforms as well.

The three isoforms differ in:

  • Substrate affinity: Has1 typically has lower affinity for UDP-sugar precursors

  • Molecular weight of products: Has1 produces smaller hyaluronan polymers compared to Has2

  • Expression regulation: Has1 is typically upregulated by pro-inflammatory stimuli

These differences should be considered when designing comparative studies between the isoforms. When attempting to characterize all three Xenopus laevis Has enzymes, researchers should optimize reaction conditions for each isoform separately rather than applying uniform conditions.

Which Xenopus laevis tissues express the highest levels of Has1 for recombinant protein research?

Determining optimal tissue sources for Has1 expression is crucial for recombinant protein research. In Xenopus laevis, several tissues can be sampled using established protocols:

  • Heart tissue can be rapidly accessed and sampled by first identifying the beating heart, reducing the coracoid bones for better access, and carefully excising the ventricle .

  • Liver tissue, which is often used for studying gene expression, can be sampled by identifying the three distinct lobes of the liver, carefully severing the left lobe while avoiding damage to surrounding structures .

  • Skin tissue is particularly relevant for Has1 research as studies in mammalian systems have shown that HAS1 is upregulated during keratinocyte differentiation and is important for skin homeostasis .

When extracting tissues, researchers should follow established protocols for adult Xenopus organ sampling to ensure tissue integrity and minimize cross-contamination . All samples should be immediately rinsed in chilled PBS or 0.7x PBS depending on experimental needs, and examined under magnification to ensure quality before processing for Has1 isolation or expression analysis.

What are the most effective protocols for preparing Xenopus laevis tissue samples for Has1 expression analysis?

For optimal Has1 expression analysis from Xenopus laevis tissues, researchers should follow these methodological steps:

  • Tissue preparation:

    • Properly euthanize the animal following institutional guidelines, typically using MS-222 (tricaine methanesulfonate) at 5 g/L with 5 g/L sodium bicarbonate, pH ≥7

    • Record animal details (species, strain, sex, age, health status)

    • Perform tissue extraction as described in question 4.1

  • RNA preservation and extraction:

    • Immediately place tissue samples in RNAlater or flash-freeze in liquid nitrogen

    • Extract total RNA using TRIzol or specialized RNA isolation kits optimized for amphibian tissues

    • Assess RNA quality using spectrophotometry and gel electrophoresis

  • qPCR analysis:

    • Design primers specific to Xenopus laevis Has1, ensuring they don't cross-react with Has2 or Has3

    • Perform reverse transcription using oligo(dT) primers

    • Conduct qPCR with appropriate reference genes (e.g., gapdh, actb)

This methodological approach ensures reliable quantification of Has1 expression across different tissues and experimental conditions.

How can mutagenesis studies of Xenopus laevis Has1 provide insights into enzyme mechanism?

Targeted mutagenesis of Xenopus laevis Has1 offers valuable insights into enzymatic mechanisms and structure-function relationships. Research has shown that mutations of specific cysteine or serine residues in Xenopus Has1 can significantly alter the size of the hyaluronan chain produced, suggesting these amino acids play crucial roles in polymer binding and elongation . For effective mutagenesis studies:

  • Target conserved residues in the catalytic domain based on sequence alignments with other species

  • Focus on cysteine residues that may form disulfide bridges critical for enzyme conformation

  • Investigate serine residues potentially involved in substrate binding or catalysis

  • Examine amino acids unique to Xenopus Has1 that may explain its non-reducing end synthesis mechanism

Site-directed mutagenesis should be conducted using optimized primers with minimal mismatches. Following mutation, recombinant proteins should be expressed and subjected to comprehensive activity assays to evaluate changes in substrate affinity, reaction kinetics, and product size distribution. This approach can reveal key insights about the unique directional synthesis mechanism of Xenopus Has1 compared to mammalian orthologs.

What advanced analytical techniques are most appropriate for studying Xenopus laevis Has1 catalytic mechanisms?

Several sophisticated analytical techniques can provide deeper insights into Xenopus laevis Has1 catalytic mechanisms:

  • Enzyme kinetics using varying substrate concentrations to determine:

    • Km and Vmax values for UDP-GlcUA and UDP-GlcNAc

    • Effects of divalent cations on reaction rates

    • Inhibition patterns and mechanisms

  • Mass spectrometry for detailed structural analysis:

    • Liquid chromatography-mass spectrometry (LC-MS) to analyze reaction intermediates

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to identify substrate binding regions

    • Crosslinking mass spectrometry to determine protein-substrate interactions

  • Advanced microscopy techniques:

    • Single-molecule fluorescence resonance energy transfer (smFRET) to observe conformational changes during catalysis

    • Total internal reflection fluorescence microscopy (TIRFM) to visualize individual enzyme molecules during catalysis

  • Computational approaches:

    • Molecular dynamics simulations of enzyme-substrate interactions

    • Quantum mechanics/molecular mechanics (QM/MM) calculations for transition state analysis

These techniques, when combined, can provide a comprehensive understanding of the unique catalytic properties of Xenopus laevis Has1, particularly its non-reducing end synthesis mechanism that distinguishes it from mammalian orthologs.

What are common challenges in expressing recombinant Xenopus laevis Has1 and how can they be addressed?

Researchers frequently encounter several obstacles when expressing recombinant Xenopus laevis Has1:

ChallengePossible CausesSolutions
Low expression levelsCodon usage bias, toxic effects on host cellsOptimize codon usage for expression system, use inducible expression systems, lower induction temperature
Protein misfoldingImproper membrane insertion, incorrect disulfide bond formationInclude chaperone co-expression, optimize growth temperature (typically 27-30°C for Xenopus proteins)
Inactivity of purified proteinDetergent-induced conformational changes, cofactor deficiencyScreen multiple detergents, include glycerol and divalent cations in buffers
Protein aggregationHydrophobic transmembrane domainsAdd solubilizing agents, express truncated versions lacking membrane-spanning regions
DegradationProtease susceptibilityInclude protease inhibitors, optimize purification temperature and speed

Systematic optimization of expression conditions is essential. For instance, while mammalian expression systems are typically preferred, researchers might need to screen multiple cell lines (CHO, HEK293, COS-7) to identify optimal hosts. Additionally, the construction of fusion proteins with soluble tags (MBP, SUMO) can enhance solubility while maintaining activity.

How can I optimize activity assays for detecting low levels of recombinant Xenopus laevis Has1 activity?

Detecting low levels of Xenopus laevis Has1 activity requires assay optimization strategies:

  • Substrate optimization:

    • Use higher UDP-sugar concentrations (2-5 mM) as Has1 requires elevated substrate levels for activation

    • Ensure fresh preparation of UDP-sugars to avoid degradation

    • Include both Mg²⁺ and Mn²⁺ in reaction buffers to maximize activity

  • Reaction condition enhancement:

    • Optimize buffer composition (pH 7.0-7.5 typically optimal)

    • Include stabilizing agents like glycerol (10-15%)

    • Perform reactions at physiologically relevant temperatures for Xenopus (23-25°C)

  • Detection sensitivity improvement:

    • Extend reaction times (up to 24 hours) for accumulation of product

    • Use sensitive hyaluronan detection methods like ELISA-like assays with hyaluronan-binding protein

    • Implement radiometric assays with ³H-labeled UDP-sugars for maximum sensitivity

  • Signal enhancement approaches:

    • Concentrate reaction products using appropriate molecular weight cutoff filters

    • Employ signal amplification techniques in detection systems

    • Use fluorescent or chemiluminescent detection methods instead of colorimetric ones

By implementing these methodological improvements, researchers can significantly enhance the detection limits for Xenopus laevis Has1 activity, enabling meaningful characterization even with enzymes exhibiting low intrinsic activity.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.