Recombinant Xenopus laevis Hyaluronan synthase 2 (has2)

Shipped with Ice Packs
In Stock

Description

Molecular Overview of Recombinant Xenopus laevis Has2

Recombinant X. laevis Has2 is a 551-amino acid protein (UniProt ID: O57427) produced in Escherichia coli with an N-terminal His tag for purification . Key specifications include:

PropertyDetails
Expression SystemE. coli
Molecular Weight~63 kDa (calculated)
Purity>90% (SDS-PAGE)
StorageLyophilized powder in Tris/PBS buffer (6% trehalose, pH 8.0) at -80°C
Reconstitution0.1–1.0 mg/mL in deionized water with 50% glycerol for stability

The full-length protein includes conserved domains for substrate binding (UDP-GlcA and UDP-GlcNAc) and HA polymerization, critical for its enzymatic activity .

Biological Function and Mechanism

Has2 catalyzes the alternating addition of glucuronic acid (GlcA) and N-acetylglucosamine (GlcNAc) to form HA, which is extruded through a membrane channel during synthesis . Key roles include:

  • Embryonic Development: Has2 is widely expressed during embryogenesis, driving tissue expansion via high-molecular-weight (HMW) HA production .

  • Choroidal Thickening: In chicks, Has2 upregulation during myopia recovery correlates with HA accumulation, facilitating rapid stromal expansion .

  • Cancer Progression: Overexpression in carcinomas (e.g., breast, ovarian) promotes tumor metastasis via HA-CD44 interactions .

Enzymatic Properties and Kinetic Data

Comparative studies of vertebrate HAS isoforms reveal unique features of Has2 :

ParameterHas2Has1Has3
Km (UDP-GlcA)0.18 mM0.44 mM0.32 mM
Km (UDP-GlcNAc)0.29 mM0.61 mM0.74 mM
HA Molecular Weight1.6–3.2 MDa1.6–3.2 MDa1.0–2.0 MDa
Substrate AffinityHighestModerateLowest

Has2 exhibits the lowest Km values, indicating superior substrate affinity, and produces HMW HA at higher rates than other isoforms . Structural studies of X. laevis Has1 (a homolog) suggest conserved mechanisms for HA translocation, including a gating loop (WGTRG motif) that coordinates UDP release .

In Vitro HA Synthesis

Recombinant Has2 is used to study HA biosynthesis kinetics. Pulse-field gel electrophoresis shows its capacity to generate HA chains >1.6 MDa, mimicking native HMW HA .

Disease Models

  • Ocular Research: Has2-driven HA accumulation in chick choroids modulates refractive error correction during myopia recovery .

  • Cancer Studies: Elevated Has2 expression in breast cancer (21 publications) and bladder cancer (7 publications) underscores its role in tumor microenvironment remodeling .

Clinical and Industrial Relevance

  • Therapeutic Target: Inhibiting Has2 in cancers may reduce metastasis .

  • Biomaterials: Engineered Has2 variants could optimize HA production for medical applications (e.g., viscosupplementation, wound healing).

Future Directions

  • Mechanistic Studies: Resolving Has2’s full structure to elucidate HA length regulation.

  • Gene Therapy: Modulating Has2 expression to treat HA-related pathologies (e.g., osteoarthritis, fibrosis).

Product Specs

Form
Lyophilized powder

Note: We will prioritize shipping the format currently in stock. If you require a specific format, please specify this in your order notes. We will fulfill requests to the best of our ability.

Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.

Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.

Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Before opening, briefly centrifuge the vial to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference for your preparation.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer components, temperature, and protein stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C. Lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.

The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.

Synonyms
has2; Hyaluronan synthase 2; Hyaluronate synthase 2; Hyaluronic acid synthase 2; HA synthase 2; xHAS2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-551
Protein Length
full length protein
Species
Xenopus laevis (African clawed frog)
Target Names
has2
Target Protein Sequence
MHCERFICILRIIGTTLFGVSLLLGISAAYIVGYQFIQTDNYYFSFGLYGAILALHLIIQ SLFAFLEHRKMKRSLETPIKLNKSVALCIAAYQEDEDYLRKCLLSVKRLTYPGMKVIMVI DGNSDDDLYMMNIFREIMGNDSCATYVWKNNFHMKGPNETDETHRESMQHVTQMVLSNRN VCIMQKWNGKREVMYTAFKALGRSVDYVQVCDSDTVLDPASSVEMVKVLEEDIMVGGVGG DVQILNKYDSWISFLSSVRYWMAFNIERACQSYFGCVQCISGPLGMYRNSLLHEFIEDWY NQEFLGSQCSFGDDRHLTNRVLSLGYATKYTARSKCLTETPTEYLRWLNQQTRWSKSYFR EWLYNSLWFHKHHLWMTYEAVITGFFPFFLIATVIQLFYRGRIWNILLFLLTVQLVGLIK SSFASALRGNIVMVFMSFYSVLYMSSLLPAKMFAIATINKAGWGTSGRKTIVVNFIGLIP ITVWFTILLGGVCYTIWRETKKPFSESEKIVLAVGAILYACYWVMLLTMYVSLVMKCGRR RKEPQHDLVLA
Uniprot No.

Target Background

Function

Recombinant Xenopus laevis Hyaluronan synthase 2 (HAS2) catalyzes the addition of GlcNAc or GlcUA monosaccharides to the nascent hyaluronan polymer. This enzyme is essential for hyaluronan synthesis, a key component of most extracellular matrices. Hyaluronan plays a critical structural role in tissue architecture and regulates cell adhesion, migration, and differentiation.

Gene References Into Functions
  1. In the absence of XHas2, early myoblasts undergo apoptosis, preventing the completion of muscle differentiation. XHas2 activity is also crucial for the migration of hypaxial muscle cells and trunk neural crest cells (NCC). PMID: 16421194
Database Links

KEGG: xla:399146

UniGene: Xl.608

Protein Families
NodC/HAS family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Xenopus laevis Hyaluronan Synthase 2 and its functional significance?

Hyaluronan Synthase 2 (Has2) is a transmembrane enzyme responsible for the synthesis of hyaluronan, a crucial component of the extracellular matrix. In Xenopus laevis, Has2 (also known as xHAS2) consists of 551 amino acids and plays essential roles in embryonic development, tissue homeostasis, and cellular signaling pathways. The enzyme contains multiple transmembrane domains and catalyzes the polymerization of UDP-N-acetylglucosamine and UDP-glucuronic acid to form hyaluronan chains. Has2 expression patterns vary throughout Xenopus development, with significant roles during gastrulation, neurulation, and organogenesis phases. The recombinant form typically includes a His-tag to facilitate purification and experimental manipulation .

How does recombinant Xenopus laevis Has2 differ from Has2 in other vertebrate models?

Xenopus laevis Has2 shares significant sequence homology with Has2 proteins from other vertebrates, including humans, mice, and rats, but possesses unique structural and functional characteristics. The full-length protein (551 amino acids) contains conserved catalytic domains while exhibiting species-specific post-translational modifications and regulatory elements. Unlike mammalian models, Xenopus laevis is allotetraploid, potentially harboring multiple Has2 alloalleles with subtle functional differences. This contrasts with the diploid Xenopus tropicalis, which may offer cleaner genetic backgrounds for certain experiments. Comparative studies between Xenopus Has2 and mammalian orthologs reveal evolutionary conservation of core enzymatic functions while highlighting differences in regulatory mechanisms that may reflect adaptation to different developmental programs and environmental conditions .

What are the optimal storage and handling conditions for recombinant Xenopus laevis Has2 protein?

For optimal preservation of recombinant Xenopus laevis Has2 protein activity, store the lyophilized powder at -20°C to -80°C upon receipt. When preparing working solutions, reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, add glycerol to a final concentration of 5-50% (typically 50% is recommended) and aliquot to minimize freeze-thaw cycles. Working aliquots can be maintained at 4°C for up to one week, but repeated freezing and thawing should be strictly avoided as this significantly reduces enzymatic activity. The storage buffer typically consists of a Tris/PBS-based solution containing 6% trehalose at pH 8.0 to stabilize the protein structure. Before opening, briefly centrifuge the vial to bring contents to the bottom. The reconstituted protein should be handled with care to maintain the integrity of the His-tag and the native conformation of the enzyme .

How can I verify the purity and activity of recombinant Xenopus laevis Has2?

Verification of recombinant Xenopus laevis Has2 purity and activity requires multiple complementary approaches. For purity assessment, perform SDS-PAGE analysis under reducing conditions, which should demonstrate a predominant band at approximately 63 kDa (the molecular weight may vary slightly depending on the tag used). A purity level greater than 90% is typically expected for high-quality preparations. Western blot analysis using specific anti-Has2 or anti-His tag antibodies can confirm protein identity. For activity verification, conduct an in vitro hyaluronan synthesis assay by incubating the recombinant protein with UDP-N-acetylglucosamine and UDP-glucuronic acid substrates, followed by quantification of hyaluronan production using methods such as enzyme-linked sorbent assays or size exclusion chromatography. Additionally, circular dichroism spectroscopy can assess proper protein folding, while mass spectrometry confirms the expected molecular weight and can detect any potential post-translational modifications .

What expression systems are most effective for producing functional recombinant Xenopus laevis Has2?

The selection of an appropriate expression system for recombinant Xenopus laevis Has2 significantly impacts protein quality and functionality. While E. coli systems provide high yield and cost-effectiveness (as seen in the commercially available Has2 protein expressed in E. coli), they may not fully reproduce post-translational modifications essential for optimal enzymatic activity. For studies requiring native-like modifications, eukaryotic expression systems such as insect cells (Sf9, Sf21) or mammalian cells (HEK293, CHO) may be preferable despite lower yields. When using prokaryotic systems, optimizing induction conditions (temperature, IPTG concentration, induction time) becomes critical to enhance soluble protein production. Codon optimization for the expression host improves translation efficiency, while fusion partners (beyond the His-tag) such as MBP or SUMO can enhance solubility. For membrane-associated functionality studies, mammalian expression systems like HEK293 cells may be essential to maintain native transmembrane domain structure and orientation .

How can I design experiments to study the role of Xenopus laevis Has2 in embryonic development?

Designing robust experiments to elucidate Xenopus laevis Has2 function in embryonic development requires a multi-faceted approach. Begin with temporal and spatial expression analysis using in situ hybridization and quantitative RT-PCR to establish Has2 expression patterns throughout developmental stages. For loss-of-function studies, design antisense morpholino oligonucleotides targeting Has2 mRNA or implement CRISPR/Cas9 genome editing to generate targeted mutations. Always include appropriate controls, such as mismatch morpholinos or rescue experiments with morpholino-resistant Has2 mRNA to validate specificity. For gain-of-function studies, microinject synthesized Has2 mRNA into specific blastomeres and analyze resulting phenotypes. Combine these approaches with lineage tracers to track cellular behaviors. For mechanistic studies, design chimeric constructs with domain swaps between Xenopus Has2 and orthologs from other species to identify functionally critical regions. The abundant eggs produced by Xenopus facilitate statistical power in these experiments, though the allotetraploid nature of X. laevis may complicate genetic analyses compared to the diploid X. tropicalis .

What methods are recommended for analyzing Has2 interactions with other proteins in Xenopus developmental contexts?

For comprehensive analysis of Has2 protein interactions during Xenopus development, employ a combination of biochemical, genetic, and imaging approaches. Co-immunoprecipitation using anti-Has2 antibodies or anti-tag antibodies (for recombinant His-tagged Has2) followed by mass spectrometry can identify novel binding partners in embryonic lysates at different developmental stages. Validate these interactions through reciprocal co-immunoprecipitation and proximity ligation assays in situ. For investigating dynamic interactions, bimolecular fluorescence complementation (BiFC) or Förster resonance energy transfer (FRET) approaches using tagged constructs microinjected into embryos allow visualization of interactions in living tissues. Yeast two-hybrid screening using Has2 domains as bait can identify additional interaction partners, though these require validation in the embryonic context. For functional validation, design co-knockdown experiments using morpholinos or CRISPR targeting both Has2 and candidate interacting proteins, followed by phenotypic analysis and rescue experiments. The unique advantages of Xenopus embryos, including their external development and large size, facilitate these biochemical and imaging approaches while enabling correlation with morphological outcomes .

How can I optimize purification protocols for recombinant Xenopus laevis Has2 to maintain enzymatic activity?

Optimizing purification of enzymatically active recombinant Xenopus laevis Has2 requires careful consideration of its transmembrane nature and catalytic requirements. When using His-tagged Has2, implement a sequential purification strategy beginning with immobilized metal affinity chromatography (IMAC) using Ni-NTA or Co-NTA resins. Critically, incorporate moderate concentrations (0.1-0.5%) of mild detergents such as DDM, CHAPS, or Triton X-100 throughout purification to solubilize the protein while preserving membrane domain structure. Maintain buffer pH between 7.5-8.0 and include stabilizing agents such as trehalose (5-10%) or glycerol (10-15%). For higher purity, follow IMAC with size exclusion chromatography using detergent-containing buffers. Throughout purification, minimize exposure to room temperature and avoid harsh elution conditions—use imidazole gradients rather than pH shifts for elution. For activity preservation, include substrate analogs (UDP-sugars at low concentrations) and divalent cations (Mg2+, Mn2+) in purification buffers. After purification, reconstitute Has2 into nanodiscs or liposomes to provide a membrane-like environment that better preserves native conformation and enzymatic activity compared to detergent micelles alone .

What techniques can detect and quantify hyaluronan production by recombinant Xenopus laevis Has2 in vitro?

Accurate detection and quantification of hyaluronan produced by recombinant Xenopus laevis Has2 requires specialized analytical techniques adapted to the unique properties of this glycosaminoglycan. For in vitro enzymatic assays, employ radiometric analysis using 14C or 3H-labeled UDP-sugar substrates followed by ion-exchange chromatography or gel filtration to separate and quantify newly synthesized hyaluronan. Alternatively, utilize non-radioactive approaches such as a coupled enzyme assay system where hyaluronan production is linked to measurable colorimetric or fluorometric changes. For size characterization of synthesized hyaluronan, implement multi-angle light scattering coupled with size exclusion chromatography or asymmetric flow field-flow fractionation. Hyaluronan-specific binding proteins like biotinylated HABP (Hyaluronan Binding Protein) enable ELISA-based quantification with sensitivity in the nanogram range. For direct visualization and localization of newly synthesized hyaluronan in cell cultures or tissue samples, employ fluorophore-conjugated hyaluronan-binding proteins combined with confocal microscopy. To assess functionality of the produced hyaluronan, evaluate its ability to bind to receptors such as CD44 using surface plasmon resonance or cell-based binding assays .

How can CRISPR/Cas9 genome editing be optimized for studying Has2 function in Xenopus laevis?

Optimizing CRISPR/Cas9 genome editing for Has2 functional studies in Xenopus laevis requires strategic considerations addressing the challenges posed by its allotetraploid genome. Design sgRNAs targeting conserved regions shared between homeologous Has2 genes to achieve simultaneous knockout of all alleles. Alternatively, design subgenome-specific sgRNAs exploiting sequence differences between homeologs for selective targeting. For microinjection, introduce Cas9 as either protein (immediate activity, reduced off-target effects) or mRNA (delayed but prolonged expression) along with sgRNAs into one-cell stage embryos. Optimize concentrations through dose-response experiments (typically 300-500 pg sgRNA and 1-2 ng Cas9 protein) to balance editing efficiency against toxicity. For phenotypic analysis, implement T7 endonuclease assays, TIDE analysis, or targeted deep sequencing to quantify editing efficiencies. To address mosaicism, analyze F0 embryos at multiple developmental stages and establish F1 knockout lines when possible. For precise modifications, provide HDR templates with at least 500-800 bp homology arms. The large embryo size facilitates microinjection into specific blastomeres for lineage-restricted knockout studies to circumvent early embryonic lethality, enabling analysis of Has2 function in specific tissues or developmental contexts .

What approaches can resolve contradictory findings in Has2 functional studies between different experimental systems?

Resolving contradictory findings in Has2 functional studies across experimental systems requires systematic analysis of multiple variables that may influence experimental outcomes. First, implement multiplatform validation by comparing Has2 function across different model systems (cell culture, Xenopus, zebrafish, mouse) using identical functional assays. When differences emerge, conduct domain swap experiments between Has2 orthologs to identify species-specific functional elements. For Xenopus-specific studies, carefully compare results between the allotetraploid X. laevis and diploid X. tropicalis to distinguish effects potentially masked by genetic redundancy. Standardize experimental parameters including developmental timing, protein expression levels, and environmental conditions across comparative studies. Employ multiple loss-of-function approaches (morpholinos, CRISPR, dominant negatives) and gain-of-function strategies (mRNA overexpression, inducible systems) to distinguish between primary and secondary effects. For contradictory in vitro versus in vivo findings, develop ex vivo assays using embryonic explants that bridge these contexts. Investigate post-translational modifications specific to different systems using mass spectrometry and phospho-proteomics. Finally, implement systems biology approaches including transcriptomics and proteomics to identify differences in molecular contexts that may explain functional discrepancies between experimental systems .

How can I address challenges in expressing full-length Xenopus laevis Has2 due to its hydrophobic transmembrane domains?

Addressing expression challenges for full-length Xenopus laevis Has2 requires strategic approaches targeting its multiple transmembrane domains. When using E. coli expression systems, implement specialized strains such as C41(DE3) or C43(DE3) specifically designed for membrane protein expression. Reduce expression temperature to 16-20°C and use lower inducer concentrations to slow protein synthesis, allowing proper membrane insertion. Fusion partners such as MBP, thioredoxin, or SUMO can enhance solubility and proper folding. For particularly recalcitrant constructs, express the protein as discrete domains, focusing separately on the catalytic region and transmembrane segments. Alternatively, transition to eukaryotic expression systems such as Pichia pastoris, insect cells, or mammalian cells that provide more sophisticated membrane protein processing machinery. When using these systems, optimize codon usage for the host and consider using native secretion signals or known efficient signal sequences. For challenging transmembrane regions, implement systematic mutagenesis of specific hydrophobic residues at the boundaries of transmembrane helices to enhance expression without compromising function. Throughout optimization, monitor expression using Western blotting with anti-His antibodies and assess functionality through activity assays to ensure modifications don't compromise enzymatic function .

What strategies can address non-specific binding issues during Has2 protein-protein interaction studies?

Non-specific binding during Has2 protein-protein interaction studies can be systematically addressed through multiple optimization strategies. For co-immunoprecipitation experiments, implement stringent washing protocols with increasing ionic strength buffers (150-500 mM NaCl) and moderate detergent concentrations (0.1-1% Triton X-100 or NP-40) to disrupt weak non-specific interactions while preserving genuine binding partners. Pre-clear lysates with appropriate control beads and pre-adsorb antibodies with irrelevant proteins to reduce background. For recombinant His-tagged Has2, include 10-20 mM imidazole in binding buffers to minimize non-specific interactions with the Ni-NTA resin. Implement reciprocal pull-downs and competitive binding assays to validate specificity. For particularly challenging cases, use crosslinking approaches with membrane-permeable crosslinkers such as DSP or formaldehyde to stabilize genuine interactions before cell lysis. Incorporate quantitative proteomics approaches with SILAC or TMT labeling to differentiate statistically significant interactions from background binding. When expressing Has2 for interaction studies, consider using inducible systems to achieve near-physiological expression levels, as overexpression can lead to non-specific associations. Finally, validate interactions through orthogonal methods such as proximity ligation assays or FRET in intact cells to confirm the biological relevance of identified interactions .

How can I troubleshoot variable enzymatic activity in recombinant Xenopus laevis Has2 preparations?

Troubleshooting variable enzymatic activity in recombinant Xenopus laevis Has2 preparations requires systematic analysis of multiple factors affecting protein integrity and catalytic function. Begin by implementing strict quality control measures including SDS-PAGE and Western blotting to verify protein integrity before each activity assay. Standardize protein quantification methods using both Bradford/BCA assays and densitometry of Coomassie-stained gels to ensure consistent protein input across experiments. For the assay itself, optimize buffer conditions systematically varying pH (7.0-8.5), ionic strength (50-200 mM NaCl), and divalent cation concentrations (Mg2+, Mn2+), as Has2 activity is highly dependent on these parameters. Implement time-course experiments to ensure measurements within the linear range of the enzyme activity. If variability persists, investigate post-translational modifications through mass spectrometry, as phosphorylation states can significantly impact Has2 activity. For membrane-associated Has2, ensure consistent membrane/detergent environments by reconstituting the protein into defined liposomes or nanodiscs rather than relying on detergent micelles alone. Monitor substrate quality rigorously, as UDP-sugars can degrade during storage; prepare fresh substrate solutions or aliquot and store at -80°C. Finally, incorporate internal standards and positive controls (commercial hyaluronan synthases with known activity) in each experiment to normalize results across different preparations and assay conditions .

How does the structure and function of Xenopus laevis Has2 compare with hyaluronan synthases from other vertebrate species?

Comparative analysis of Xenopus laevis Has2 with orthologs from other vertebrate species reveals evolutionary conservation of core catalytic machinery alongside species-specific adaptations. The protein maintains the characteristic topology featuring multiple transmembrane domains and a large cytoplasmic catalytic region observed across vertebrates. Sequence alignment shows highest homology in the catalytic domain containing the glycosyltransferase motifs responsible for UDP-sugar binding and polymerization. The Xenopus laevis Has2 protein (551 amino acids) shares approximately 80-85% sequence identity with mammalian orthologs, with variable regions primarily in the N-terminal domain and specific loops connecting the transmembrane segments. These divergent regions likely mediate species-specific regulatory interactions. Functionally, Xenopus Has2 exhibits temperature optima aligned with the poikilothermic physiology of amphibians (18-25°C) compared to the higher temperature requirements of mammalian enzymes (37°C). The enzyme kinetics and substrate preferences appear largely conserved across species, though subtle differences in processivity and product chain length have been observed. Regulatory mechanisms show more significant divergence, with species-specific phosphorylation sites and interaction motifs reflecting adaptation to different developmental programs and environmental conditions .

How do recombinant expression systems affect post-translational modifications of Xenopus laevis Has2?

Different recombinant expression systems significantly impact the post-translational modification profile of Xenopus laevis Has2, with profound implications for protein functionality. Prokaryotic systems such as E. coli offer high yield but lack the cellular machinery for eukaryotic modifications, producing Has2 devoid of glycosylation and with altered phosphorylation patterns. Mass spectrometry analyses reveal that Has2 expressed in E. coli lacks modifications at conserved N-glycosylation sites (N220 and N402) that are present in natively expressed protein. Yeast expression systems (Saccharomyces cerevisiae, Pichia pastoris) implement rudimentary glycosylation but typically produce hyperglycosylated proteins with mannose-rich structures unlike the complex glycans found in amphibian cells. Insect cell systems (Sf9, Sf21) provide improved glycosylation patterns but still lack the complex sialylation present in vertebrate cells. Mammalian expression systems (HEK293, CHO) most closely recapitulate the native modification profile but may introduce mammalian-specific modifications absent in Xenopus. Phosphorylation patterns also vary significantly across expression systems, with mass spectrometry identifying system-specific phosphorylation at regulatory residues. These differences in post-translational modifications correlate with measurable differences in enzymatic activity, with proteins expressed in more complex eukaryotic systems typically demonstrating higher specific activity and more native-like regulation compared to bacterially expressed Has2 .

What novel technologies are emerging for studying Has2 function and regulation in Xenopus development?

Emerging technologies are revolutionizing approaches to Has2 functional studies in Xenopus development. Optogenetic tools adapted for Xenopus embryos now enable spatiotemporal control of Has2 expression or activity through light-inducible promoters or protein degradation systems, allowing precise manipulation during specific developmental windows. Single-cell RNA sequencing of Xenopus embryos provides unprecedented resolution of Has2 expression patterns across cell lineages and developmental trajectories, revealing previously undetected expression domains. CRISPR activation/interference systems (CRISPRa/CRISPRi) enable targeted modulation of endogenous Has2 expression without permanent genetic modification. For protein interaction studies, proximity labeling approaches using TurboID or APEX2 fused to Has2 identify the protein's interaction network in living embryos. Advanced imaging technologies including lattice light-sheet microscopy combined with genetically encoded hyaluronan sensors allow real-time visualization of hyaluronan synthesis and deposition with subcellular resolution. Organ-on-chip technologies incorporating Xenopus tissues provide controlled microenvironments for studying Has2 function in tissue-specific contexts. Looking forward, the integration of these technologies with computational modeling approaches will enable systems-level understanding of Has2 contribution to the complex developmental processes in Xenopus .

How might engineered variants of Xenopus laevis Has2 be used to probe structure-function relationships?

Strategic engineering of Xenopus laevis Has2 variants provides powerful tools for dissecting enzyme structure-function relationships and developing novel research applications. Systematic alanine scanning mutagenesis targeting conserved residues in the catalytic domain can identify amino acids essential for UDP-sugar binding, sugar transfer, and translocation activities. Chimeric constructs swapping domains between Has2 and other glycosyltransferases (Has1, Has3, or bacterial hyaluronan synthases) can isolate regions responsible for product size determination and processivity. Site-directed mutagenesis of putative regulatory phosphorylation sites (identified through phosphoproteomic analysis) to phosphomimetic (Asp/Glu) or non-phosphorylatable (Ala) residues can elucidate regulatory mechanisms. For mechanistic studies, split Has2 constructs with complementary fragments fused to dimerization domains enable inducible reconstitution of enzymatic activity. Fluorescently tagged variants with minimal functional disruption, identified through systematic insertion scanning, allow real-time tracking of Has2 localization and trafficking. For biotechnological applications, directed evolution approaches can generate Has2 variants with enhanced stability, altered temperature optima, or modified product characteristics. Finally, incorporation of non-natural amino acids at specific positions through amber suppression technology enables precise biophysical studies including FRET-based conformational analysis during the catalytic cycle .

What are the potential applications of recombinant Xenopus laevis Has2 in regenerative medicine research?

Recombinant Xenopus laevis Has2 offers unique advantages for regenerative medicine research, building upon the remarkable regenerative capabilities of amphibians. Purified enzyme can be used to produce custom hyaluronan polymers with precise size distributions and modifications for scaffolding materials, potentially combining the beneficial properties of amphibian-specific hyaluronan with tailored structural characteristics. In comparative regeneration studies, examining differences between mammalian and amphibian Has2 regulation may reveal molecular switches that could enhance mammalian regenerative capacity. The Xenopus embryo's accessibility enables high-throughput screening of small molecule modulators of Has2 activity that could enhance wound healing or tissue regeneration. For tissue engineering applications, co-culture systems combining mammalian stem cells with Xenopus cells expressing Has2 can investigate the contribution of amphibian-specific hyaluronan to cell fate decisions and morphogenesis. Recombinant Has2 can also be incorporated into biomaterials for controlled release, potentially enhancing wound healing or reducing scarring. Furthermore, studying Has2 regulation during Xenopus tail and limb regeneration may identify critical signaling pathways that could be targeted to enhance mammalian healing responses. Importantly, the evolutionary distance between amphibian and human proteins provides unique perspectives on conserved and divergent aspects of hyaluronan biology that might not be apparent from mammalian studies alone .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.