Recombinant Xenopus laevis Hyaluronan synthase-related protein (has-rs)

Shipped with Ice Packs
In Stock

Description

HA Biosynthesis and Enzymatic Activity

  • Processivity: Recombinant has-rs synthesizes HA chains comparable to vertebrate HAS isoforms, with chain length influenced by enzymatic processivity and catalytic rates .

  • Substrate Specificity: Prefers UDP-GlcNAc and UDP-GlcA, with structural loops ensuring alternating sugar addition .

Comparative HAS Isoform Activity (In Vitro):

IsoformHA Chain Length (Da)Catalytic Rate
HAS1~120,000Slowest polymerization
HAS2>3,900,000Moderate rate
HAS3120,000–1,000,000Fastest polymerization

Recombinant Production Systems

Commercial production employs multiple platforms:

Expression HostAdvantagesProduct Code
E. coliCost-effective, high yield (full-length) RFL19455XF
YeastPost-translational modifications CSB-YP524498XBE1
BaculovirusEukaryotic folding for functional studies CSB-BP524498XBE1

Research Applications and Significance

  • Mechanistic Studies: Elucidates HA chain elongation and secretion in vertebrates .

  • Biomedical Relevance: HA dysregulation is linked to cancer metastasis and tissue fibrosis; has-rs serves as a model for therapeutic targeting .

  • Biotechnology: Engineered variants explore HA polymer length control for industrial applications (e.g., viscoelastic biomaterials) .

Challenges and Future Directions

  • Structural Dynamics: Further cryo-EM studies are needed to resolve conformational changes during HA elongation .

  • In Vivo Function: Limited data on has-rs-specific roles in Xenopus development warrant genetic knockout studies .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your needs as much as possible.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery estimates, please consult your local distributor.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, we recommend briefly centrifuging the vial to bring the contents to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is established during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
has-rs; hasrs; Hyaluronan synthase-related protein; Hyaluronan synthase-related sequence; xHAS-rs
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-583
Protein Length
full length protein
Species
Xenopus laevis (African clawed frog)
Target Names
has-rs
Target Protein Sequence
MENTTDPENIPVSKPKYPTIRRILSQTFRILLLFSITTAYVLGYQALCHQGLLITFGLYG AAMLLHLLMQGIFANLEIRRIEKRDGVCSFKKTVALTITGYQENPDYLRQCLESCKGMKY PKDKLKIILVIDGNNEEDVYMMEIFKEVFHGEDVGTYVWQENYHTWNIPSEESEDSSSEI SSFPWKNEGIQMVEELVRTKRCVCIMQQWGGKREVMYTAFRALGTSVDFILVCNSDIKLD KMATVELVKVLEDDDKNGAVGGDVRVWNRHDSFISFMSSLRYWMVFNMEIACQSYFDSVT YIRGSLGMYRNDILQAFLEFWYNKTFLGTRCPIGDDRFLTNRVLSMGYRTKYSHKSCAYA PCQYLRWLNQQTPWARSYFRMWFCNAQWWHQHHIWMTYESATGIFFPFFVTAVLIRLMYS SSLCNIVWLFLCIQIMSLLLSLYASWQSKKLSMVLMSLYSTLYIIWLLPCQLVALLTIAK SDWGTSGRKKVVNNYVPLFSLSIWAAVLLGGLCYSMYIGCRKDWSKPQANRELYHLLYGC AGYMAYWVLMTVIYCVSGSCCKMRSQAVPQTHDITSLSVSLLV
Uniprot No.

Target Background

Database Links

KEGG: xla:398074

UniGene: Xl.23252

Protein Families
NodC/HAS family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Xenopus laevis Hyaluronan synthase-related protein (has-rs) and how does it differ from other hyaluronan synthases?

Hyaluronan synthase-related protein (has-rs) in Xenopus laevis is a 583-amino acid transmembrane protein related to the hyaluronan synthase family . Unlike the functional hyaluronan synthases Xhas1 and Xhas2, has-rs is considered a related sequence that shares structural similarities but may have distinct functions. The key differences include:

  • Xhas1 produces hyaluronan with molecular mass of approximately 40-200 kDa

  • Xhas2 produces significantly larger hyaluronan molecules with masses above 1 million Da

  • Has-rs shows sequence homology but has potentially different enzymatic properties or regulatory functions

The protein contains multiple transmembrane domains and conserved regions typical of glycosyltransferases, suggesting a role in carbohydrate metabolism, though its precise catalytic activity may differ from other hyaluronan synthases.

What is the structural organization of the has-rs protein and what functional domains have been identified?

The full-length has-rs protein (583 amino acids) contains several key structural features:

  • N-terminal region containing the initial 583 amino acids with the sequence beginning with MENTTDPENIPVSKPKYPTIRRILSQTFRILLLFSITTAYVLGYQALCHQGLLITFGLYG

  • Multiple predicted transmembrane domains typical of membrane-bound glycosyltransferases

  • Conserved cytoplasmic catalytic domain likely involved in substrate binding

  • C-terminal region with regulatory functions

How is has-rs expression regulated during Xenopus development?

The expression of has-rs follows patterns similar to other hyaluronan synthases during Xenopus development. Key aspects include:

  • Expression is developmentally regulated, with specific temporal patterns during embryogenesis

  • Spatial expression is particularly notable in regions where hyaluronan accumulates, including between germ layers and in mesenchymal tissues

  • Expression is enriched in structures such as the neural tube lumen, embryonic gut, hepatic cavity, and developing heart

  • Regulatory mechanisms likely involve tissue-specific transcription factors and developmental signaling pathways

The correlation between has-rs expression patterns and hyaluronan distribution suggests coordinated regulation with developmental processes, though the precise mechanisms controlling has-rs transcription remain under investigation.

What are the recommended protocols for recombinant has-rs protein expression and purification?

Based on established methodologies for recombinant has-rs:

  • Expression system: E. coli has proven effective for producing recombinant has-rs with N-terminal His-tag

  • Construct design: Full-length (1-583 amino acids) with N-terminal His-tag facilitates purification while maintaining protein functionality

  • Purification strategy:

    • Affinity chromatography using Ni-NTA columns for His-tagged protein

    • Consider including protease inhibitors during lysis to prevent degradation

    • Perform gradual elution with imidazole gradient for optimal purity

  • Quality control: Verify purity (>90%) using SDS-PAGE analysis

  • Lyophilization: Final product is typically prepared as a lyophilized powder for stability

The recombinant protein should be stored in appropriate buffer conditions (Tris/PBS-based buffer with 6% trehalose, pH 8.0) to maintain stability and activity .

What are the optimal storage and handling conditions for maintaining has-rs stability and activity?

For optimal has-rs stability:

  • Long-term storage:

    • Store lyophilized protein at -20°C or -80°C

    • Add glycerol (50% final concentration) to reconstituted protein for freeze-thaw protection

    • Aliquot to avoid repeated freeze-thaw cycles, which significantly reduce activity

  • Working solutions:

    • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

    • Working aliquots can be stored at 4°C for up to one week

    • Avoid repeated freeze-thaw cycles

  • Reconstitution procedure:

    • Briefly centrifuge vial before opening to bring contents to bottom

    • Use sterile techniques to prevent contamination

    • Allow complete dissolution before experimental use

Maintaining appropriate pH (around 8.0) and including stabilizers like trehalose in storage buffers significantly extends shelf life and preserves enzymatic activity.

What experimental assays are most effective for measuring has-rs activity and function?

Several complementary approaches can be used to assess has-rs activity:

  • Hyaluronan synthesis assays:

    • Radiometric assay using UDP-[14C]GlcUA and UDP-GlcNAc substrates

    • Analysis of reaction products by gel filtration chromatography

    • Comparison with known hyaluronan standards

  • Binding studies:

    • Substrate binding analysis using surface plasmon resonance

    • Competitive binding assays with labeled substrates

    • Analysis of binding kinetics and affinity constants

  • Functional complementation:

    • Expression in hyaluronan synthase-deficient cell lines

    • Restoration of hyaluronan production as measured by ELISA or histochemical staining

    • Comparison with established hyaluronan synthases (Xhas1, Xhas2)

  • In vivo activity assessment:

    • Microinjection of has-rs mRNA into Xenopus embryos

    • Analysis of hyaluronan accumulation using neurocan-alkaline phosphatase fusion protein

    • Phenotypic rescue experiments in morpholino knockdown embryos

These methodologies should be validated using positive controls (active hyaluronan synthases) and negative controls (catalytically inactive mutants).

How does has-rs function compare with other Xenopus hyaluronan synthases (Xhas1 and Xhas2)?

Comparative analysis reveals important functional differences:

Featurehas-rsXhas1Xhas2
Molecular Weight~65 kDaSimilarSimilar
Hyaluronan Product SizeNot fully characterized40-200 kDa>1,000 kDa (1 MDa)
Expression PatternSimilar to Xhas1/2Germ layers, mesenchymeNeural tube, gut, heart
Enzymatic ActivityPotentially regulatoryConfirmed synthaseConfirmed synthase
Substrate SpecificityUnder investigationUDP-GlcUA and UDP-GlcNAcUDP-GlcUA and UDP-GlcNAc

The significant difference in product size between Xhas1 and Xhas2 suggests distinct roles in embryonic development, with larger hyaluronan potentially providing structural support in specific tissues . Has-rs may function in a regulatory capacity or produce hyaluronan with unique properties that require further characterization.

What are the implications of different hyaluronan chain lengths produced by various synthases during development?

The differential production of hyaluronan chain lengths has significant developmental implications:

  • Tissue-specific requirements:

    • Shorter chains (40-200 kDa) produced by Xhas1 may facilitate cell migration and signaling

    • Longer chains (>1 MDa) from Xhas2 likely provide structural support and hydration

    • Has-rs may produce intermediate lengths or regulate other synthases

  • Developmental timing:

    • Different chain lengths may be required at specific developmental stages

    • Sequential expression of synthases could modulate extracellular matrix properties

    • Spatiotemporal regulation ensures appropriate tissue architecture

  • Signaling functions:

    • Hyaluronan fragments of different sizes interact with distinct receptors (CD44, RHAMM)

    • Size-dependent signaling cascades influence cell behavior and fate determination

    • Has-rs may produce hyaluronan with unique signaling properties

Understanding the regulation and functional significance of these different chain lengths is crucial for elucidating the role of hyaluronan in embryonic development and morphogenesis.

What experimental approaches can be used to study has-rs function in Xenopus development?

Several sophisticated methodologies can elucidate has-rs function:

  • Loss-of-function studies:

    • CRISPR/Cas9 gene editing to generate has-rs mutants

    • Morpholino-mediated knockdown with careful control for off-target effects

    • Dominant-negative constructs to interfere with endogenous has-rs function

  • Gain-of-function studies:

    • Microinjection of has-rs mRNA at specific developmental stages

    • Tissue-specific overexpression using appropriate promoters

    • Inducible expression systems to control timing of has-rs activation

  • Reporter systems:

    • Fusion of has-rs with fluorescent proteins to track localization

    • Generation of transgenic reporter lines expressing GFP under has-rs promoter

    • Visualization of hyaluronan distribution using labeled binding proteins

  • Biochemical analysis:

    • Immunoprecipitation to identify protein interaction partners

    • Metabolic labeling to track hyaluronan synthesis dynamics

    • Mass spectrometry to characterize post-translational modifications

These approaches, when used in combination, can provide comprehensive insights into has-rs function during critical developmental processes.

How can researchers distinguish between the functions of different hyaluronan synthases in experimental settings?

Distinguishing between functionally similar proteins requires specialized approaches:

  • Enzyme-specific inhibitors:

    • Development of selective small-molecule inhibitors

    • Use of isoform-specific blocking antibodies

    • Structure-based design of competitive inhibitors

  • Molecular tools:

    • Generation of chimeric constructs swapping domains between synthases

    • Site-directed mutagenesis targeting catalytic residues

    • Isoform-specific siRNAs or morpholinos with demonstrated specificity

  • Analytical techniques:

    • Pulse-chase experiments to characterize synthesis kinetics

    • Size-exclusion chromatography to analyze product sizes

    • Mass spectrometry to detect isoform-specific modifications

  • Genetic approaches:

    • Rescue experiments using specific synthases in knockdown backgrounds

    • Double and triple knockdown combinations

    • Creation of isoform-specific knockout lines

What are the current hypotheses regarding has-rs evolution and its relationship to functional hyaluronan synthases?

Evolutionary analysis of has-rs suggests several hypotheses:

  • Gene duplication and divergence:

    • Has-rs likely arose from duplication of an ancestral hyaluronan synthase gene

    • Subsequent divergence may have led to specialized or regulatory functions

    • Conservation across species suggests important biological roles

  • Neo-functionalization:

    • Has-rs may have acquired novel functions distinct from hyaluronan synthesis

    • Potential roles in regulating other synthases or interacting with different substrates

    • May represent an evolutionary innovation specific to amphibian development

  • Regulatory adaptation:

    • Sequence divergence may reflect adaptation to specific developmental contexts

    • Changes in promoter regions could enable tissue-specific expression patterns

    • Post-translational regulation mechanisms may differ from other synthases

Comparative genomic analyses across species and detailed structure-function studies are needed to test these hypotheses and understand the evolutionary significance of has-rs.

What are common challenges in recombinant has-rs expression and how can they be addressed?

Researchers commonly encounter several challenges when working with recombinant has-rs:

  • Protein solubility issues:

    • Challenge: Transmembrane domains can cause aggregation and inclusion body formation

    • Solution: Optimize expression conditions (temperature, IPTG concentration, induction time)

    • Alternative: Consider using solubility tags (SUMO, MBP) or expressing specific domains

  • Purification difficulties:

    • Challenge: Membrane proteins often co-purify with lipids and other membrane components

    • Solution: Include mild detergents in purification buffers

    • Recommendation: Consider two-step purification (affinity followed by size exclusion)

  • Activity loss during processing:

    • Challenge: Lyophilization can affect protein conformation and activity

    • Solution: Include stabilizers like trehalose (6%) in buffer formulations

    • Best practice: Validate activity after each purification step

  • Freeze-thaw degradation:

    • Challenge: Repeated freeze-thaw cycles significantly reduce activity

    • Solution: Aliquot protein and store with 50% glycerol at -20°C/-80°C

    • Alternative: Maintain working stocks at 4°C for up to one week

Implementing these strategies can significantly improve recombinant has-rs quality and experimental reproducibility.

What controls should be included when studying has-rs function in experimental systems?

Rigorous experimental design requires appropriate controls:

  • Positive controls:

    • Well-characterized hyaluronan synthases (Xhas1, Xhas2) with known activity

    • Commercial hyaluronan standards of defined molecular weights

    • Previously validated experimental conditions

  • Negative controls:

    • Catalytically inactive mutants (site-directed mutagenesis of conserved residues)

    • Heat-inactivated enzyme preparations

    • Buffer-only controls for background activity

  • Specificity controls:

    • Competitive inhibitors of hyaluronan synthesis

    • Digestion with specific hyaluronidases to confirm product identity

    • Substrate analogs to demonstrate specificity

  • Technical controls:

    • Freshly prepared versus stored protein comparisons

    • Protein stability assessments under experimental conditions

    • Batch-to-batch consistency validation

Including these controls enhances data reliability and facilitates troubleshooting when unexpected results occur.

What are emerging technologies that could advance our understanding of has-rs function?

Several cutting-edge approaches show promise for has-rs research:

  • Cryo-electron microscopy:

    • High-resolution structural determination of membrane-embedded has-rs

    • Visualization of conformational changes during catalytic cycle

    • Structure-based drug design targeting specific hyaluronan synthases

  • Single-molecule techniques:

    • Real-time observation of has-rs catalytic activity

    • Measurement of processivity and chain elongation kinetics

    • Detection of protein-protein interactions at the single-molecule level

  • Genome editing in Xenopus:

    • CRISPR/Cas9-mediated generation of has-rs knockout lines

    • Precise introduction of point mutations to test structure-function hypotheses

    • Creation of reporter knock-ins for live imaging of has-rs expression

  • Systems biology approaches:

    • Integration with Xenopus expression databases like Axeldb

    • Network analysis of has-rs interactions with developmental pathways

    • Computational modeling of hyaluronan synthesis dynamics

These technologies, combined with traditional biochemical and developmental approaches, will provide deeper insights into has-rs function and regulation.

What are the most significant unanswered questions regarding has-rs function and regulation?

Several key questions remain unresolved:

  • Catalytic activity:

    • Does has-rs possess hyaluronan synthase activity, or does it serve another function?

    • If active, what is the size range and structural characteristics of its products?

    • How do its catalytic properties compare with Xhas1 and Xhas2?

  • Developmental roles:

    • What are the consequences of has-rs loss or overexpression on Xenopus development?

    • Does has-rs function redundantly with other synthases or have unique roles?

    • How does has-rs contribute to tissue-specific hyaluronan composition?

  • Regulatory mechanisms:

    • What transcription factors control has-rs expression during development?

    • How is has-rs activity regulated post-translationally?

    • Does has-rs interact with or regulate other hyaluronan synthases?

  • Evolutionary significance:

    • Why has has-rs been conserved during evolution?

    • Does it represent an adaptation specific to amphibian development?

    • How does has-rs function compare across different vertebrate species?

Addressing these questions will require interdisciplinary approaches combining biochemistry, developmental biology, and evolutionary analysis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.