Recombinant Xenopus laevis Insulin-induced gene 1 protein (insig1)

Basic Research Questions

• What is Insulin-induced gene 1 (insig1) protein in Xenopus laevis and what are its primary functions?

  Xenopus laevis insig1 is a 251-amino acid membrane protein that functions primarily as a regulator of lipid metabolism. The protein contains six transmembrane domains with both N and C termini facing the cytosol . Like its mammalian counterparts, X. laevis insig1 mediates sterol-dependent regulation by:

  • Regulating sterol regulatory element-binding protein (SREBP) activation

  • Controlling HMG-CoA reductase (HMGCR) degradation

  • Responding to oxysterols to maintain cellular lipid homeostasis

  The amino acid sequence of Xenopus laevis insig1 is: MQTLEEHCWSCSCTRGRDKKGTKVSAWLARRVGKAMSSLNSLLSLAYSTLASSEGRSLIQRSLVLFTVGVFLALVLNLLQIQRNVTLFPEEVIATIFSSAWWVPPCCGTAAAVVGLLYPCIDSRIGEPHKFKREWASVMRCIAVFVGINHASAKLDFANNVQLSLTLAALSLGLWWTFDRSRSGLGLGITIAFLATLITQFLVYNGVYQYTSPDFLYIRSWLPCIFFSGGVTVGNIGRQLAMGSSEKTHGD

• How is recombinant Xenopus laevis insig1 protein typically produced for research purposes?

  Recombinant X. laevis insig1 is typically produced through the following methodology:

  • Expression system: Most commonly expressed in E. coli systems with N-terminal tags (typically His-tag) to facilitate purification

  • Vector selection: Plasmids containing strong promoters (T7, tac) are used for efficient expression

  • Protein extraction: As a membrane protein, specialized detergent-based extraction methods are required

  • Purification process: Typically involves affinity chromatography using the His-tag, followed by size exclusion chromatography

  The resulting protein is usually stored in a Tris/PBS-based buffer with 6% trehalose at pH 8.0 and is often lyophilized for long-term stability .

• What are the key differences between Xenopus laevis insig1 and its mammalian homologs?

  Comparative analysis reveals several important distinctions:

  Feature	Xenopus laevis insig1	Human insig1	Mouse insig1
  Length	251 amino acids	277 amino acids	277 amino acids
  Sequence homology	Reference	~78% identity	~76% identity
  Transmembrane domains	6	6	6
  N-terminal region	Shorter	Longer	Longer
  Key functional residues	Conserved	Conserved	Conserved

  Despite these differences, the core functional domains responsible for sterol sensing and protein-protein interactions remain highly conserved across species, suggesting functional conservation .

• What verification methods should be used to confirm the identity and quality of recombinant Xenopus laevis insig1?

  Multiple orthogonal techniques should be employed:

  • SDS-PAGE: Confirms expected molecular weight (~30-38 kDa depending on tags)

  • Western blot: Using specific antibodies against either the tag or insig1 epitopes

  • Mass spectrometry: For precise molecular weight determination and peptide mapping

  • Circular dichroism: To verify proper secondary structure (predominantly α-helical as expected for a transmembrane protein)

  • Functional assays: Testing binding to known partners like SCAP or measuring inhibition of SREBP cleavage

  Purity should exceed 90% as determined by SDS-PAGE for most research applications .

Advanced Research Questions

• How can we design experiments to investigate Xenopus laevis insig1's role in lipid metabolism using oocyte systems?

  Xenopus oocytes provide an excellent system for studying insig1 function because they possess endogenous IGF-I receptors but have little to no endogenous IRS-1 . A comprehensive experimental approach would include:

  1. Microinjection system setup:

     • Prepare recombinant X. laevis insig1 protein in injection buffer

     • Optimize microinjection parameters (50-100 nl per oocyte)

     • Include control injections (buffer only, heat-inactivated protein)

  2. Functional readouts:

     • Measure SREBP processing via Western blot before and after insig1 injection

     • Monitor lipid accumulation using fluorescent dyes (Nile Red, BODIPY)

     • Quantify expression of lipogenic genes (FASN, SCD1) by qRT-PCR

  3. Pharmacological interventions:

     • Test sterol dependence using various oxysterols (25-HC at 5μM is optimal)

     • Examine insulin response (10-100 nM range)

     • Apply specific inhibitors to dissect downstream pathways

  This approach allows direct assessment of insig1's role while leveraging the advantages of the Xenopus oocyte system .

• What are the challenges in expressing and purifying functional Xenopus laevis insig1 as a membrane protein, and how can these be overcome?

  Membrane proteins like insig1 present several technical challenges:

  1. Expression barriers and solutions:

     • Challenge: Toxicity to host cells due to membrane integration

     • Solution: Use C41(DE3) or C43(DE3) E. coli strains specifically designed for membrane protein expression; consider lower induction temperatures (16-20°C)

     • Challenge: Protein misfolding and aggregation

     • Solution: Co-express with chaperones (GroEL/GroES); add chemical chaperones like glycerol (5-10%) to growth media

  2. Extraction and purification challenges:

     • Challenge: Maintaining native conformation during solubilization

     • Solution: Screen detergents systematically (DDM, LMNG, GDN); consider nanodisc or liposome reconstitution

     • Challenge: Low yields and stability issues

     • Solution: Optimize buffer conditions (add glycerol, specific lipids); use stabilizing additives like cholesterol hemisuccinate

  3. Functional verification:

     • Challenge: Confirming proper folding and activity

     • Solution: Use binding assays with known partners (SCAP, oxysterols); perform thermal stability assays in different conditions

• How can CRISPR/Cas9 technology be applied to study insig1 function in Xenopus laevis models?

  CRISPR/Cas9 genome editing in X. laevis requires specialized approaches due to its allotetraploid genome:

  1. Design considerations:

     • Target highly conserved regions between homeologs (L and S chromosomes)

     • Design multiple guide RNAs (minimum of 3-4) to ensure efficient knockout

     • Include deep sequencing validation of potential off-targets

  2. Experimental protocol:

     • Inject Cas9 mRNA/protein and sgRNAs into one-cell stage embryos

     • Screen F0 mosaics by sequencing and select founders with high mutation rates

     • Generate F1 generation for stable mutant lines

  3. Phenotypic analysis strategies:

     • Monitor lipid metabolism disturbances using Oil Red O staining

     • Measure expression of SREBP target genes by qRT-PCR

     • Analyze developmental effects and tissue-specific phenotypes

     • Perform rescue experiments with wild-type or mutant insig1 mRNA injection

  This approach has been successfully applied for other genes in Xenopus and can be adapted for insig1 functional studies .

• How does insig1 regulate SREBP processing in Xenopus models compared to mammalian systems?

  The regulatory mechanism appears conserved but with important species-specific nuances:

  1. Core mechanism similarities:

     • In both systems, insig1 retains SCAP/SREBP complex in the ER under high sterol conditions

     • Oxysterol binding to insig1 enhances retention activity in both systems

     • SCAP binding domains are highly conserved between Xenopus and mammals

  2. Key differences in Xenopus:

     • Regulatory kinetics may differ due to variations in N-terminal domains

     • Temperature dependence is modified to accommodate poikilothermic physiology

     • Integration with amphibian-specific metabolic pathways (e.g., hibernation, metamorphosis)

  3. Experimental evidence:

     • Studies show that Xenopus insig1 can functionally complement mammalian insig1 in cell culture

     • Both mammalian and Xenopus insig1 respond to the same set of oxysterols, though with different sensitivities

     • Differential regulation by insulin has been observed between species

• What role does insig1 play during Xenopus laevis development and metamorphosis?

  Insig1's developmental functions in Xenopus include:

  1. Expression patterns:

     • Temporally regulated expression during embryogenesis

     • Tissue-specific patterns with highest expression in developing liver, intestine, and neural tissues

     • Significant upregulation during metamorphosis (particularly in tail resorption)

  2. Functional implications:

     • Coordinates lipid metabolism reprogramming during key developmental transitions

     • Regulates cholesterol homeostasis critical for membrane remodeling

     • Interacts with thyroid hormone-mediated metabolic changes during metamorphosis

  3. Experimental approaches to study developmental roles:

     • Temporal knockout/knockdown studies with stage-specific analysis

     • Tissue-specific CRISPR targeting using electroporation

     • Integration with profiling of metamorphosis-associated gene networks

• How can recombinant Xenopus laevis insig1 be used to study protein-protein interactions in sterol sensing pathways?

  Several advanced methodological approaches can be employed:

  1. Pull-down assay optimization:

     • Use His-tagged recombinant insig1 as bait protein

     • Screen different detergent/lipid mixtures to maintain native interactions

     • Include appropriate sterol ligands (25-HC at 1-10 μM) to modulate interactions

  2. Surface Plasmon Resonance (SPR) analysis:

     • Immobilize purified insig1 on sensor chips via His-tag

     • Measure real-time binding kinetics with potential partners (SCAP, HMGCR)

     • Determine how different sterols affect binding affinities

  3. Fluorescence-based approaches:

     • Label insig1 and binding partners with appropriate FRET pairs

     • Measure interactions in reconstituted membrane systems

     • Use confocal microscopy to visualize subcellular localization in Xenopus oocytes

  4. Hydrogen-deuterium exchange mass spectrometry:

     • Map interaction interfaces and conformational changes

     • Compare binding sites between Xenopus and mammalian homologs

     • Identify sterol-induced structural changes

• What are the implications of studying insig1 in Xenopus laevis for understanding human metabolic disorders?

  Xenopus insig1 research has translational relevance:

  1. Disease modeling advantages:

     • Amphibian models bridge evolutionary gaps between zebrafish and mammals

     • Xenopus oocytes allow controlled manipulation of lipid regulatory pathways

     • Higher genetic homology to humans than other non-mammalian models (~78% for insig1)

  2. Relevant human disorders:

     • NAFLD/NASH (Non-alcoholic fatty liver disease/steatohepatitis)

     • Hypercholesterolemia and dyslipidemias

     • Insulin resistance and metabolic syndrome

  3. Translational research approaches:

     • Screen for compounds that modulate insig1 activity using Xenopus oocytes

     • Test hypotheses about genetic variants found in human patients

     • Develop tissue-specific interventions targeting the SREBP-insig1 pathway

• How can RNA-seq and proteomic approaches be integrated to study insig1 function in Xenopus models?

  Multi-omics integration provides powerful insights:

  1. Experimental design for comprehensive profiling:

     • Generate insig1 knockout/knockdown Xenopus models

     • Collect tissues at key developmental stages or after specific metabolic challenges

     • Perform parallel RNA-seq, proteomics, and lipidomics analysis

  2. Data integration workflow:

     • Align transcriptomic changes with proteome alterations

     • Identify discordant mRNA-protein pairs suggesting post-transcriptional regulation

     • Map changes to metabolic pathways using specialized amphibian databases

  3. Advanced computational analysis:

     • Apply gene regulatory network inference algorithms

     • Use pathway enrichment with Xenopus-specific annotations

     • Develop predictive models of insig1-dependent metabolic regulation

  This approach has successfully identified insig1-regulated pathways in other models and can be adapted for Xenopus research .