Recombinant Xenopus laevis Lipid phosphate phosphatase-related protein type 5 (lppr5)

Shipped with Ice Packs
In Stock

Description

Functional Insights

Biological role:

  • Catalyzes dephosphorylation of lipid phosphates, regulating lipid signaling and membrane dynamics

  • Implicated in neuronal plasticity and developmental processes via lipid metabolism modulation

Enzyme classification:

  • EC 3.1.3.- (Phosphatidic acid phosphatase activity)

Species-specific notes:

  • Xenopus laevis has two subgenomes (Long [.L] and Short [.S]), but recombinant lppr5 is derived from the Long subgenome (UniProt: Q6GM05)

Research Applications

Experimental uses:

  • Antibody development: Polyclonal and monoclonal antibodies against lppr5 enable Western blotting, immunohistochemistry, and ELISA

  • Functional studies: Used in Xenopus egg extract systems to investigate protein depletion/complementation effects on cell cycle regulation

  • Structural analysis: Crystallization studies to resolve catalytic mechanisms

Key findings:

  • Recombinant lppr5 binds dimeric ligands (e.g., CSF1) via cross-linking assays, suggesting cooperative binding mechanisms

  • Partial lppr5 constructs retain enzymatic activity, enabling domain-specific functional analyses

Comparative Analysis of Recombinant Variants

VariantExpression SystemMolecular WeightApplications
Full-length (1-314)Mammalian cells~35 kDaFunctional assays, antibody production
Partial (e.g., 1-200)E. coli~22 kDaStructural studies, kinase assays

Technical Considerations

Stability:

  • Avoid repeated freeze-thaw cycles; aliquot for single-use

  • Degrades rapidly at room temperature without glycerol stabilizers

Cross-reactivity:

  • Antibodies against Xenopus lppr5 show reactivity with human, mouse, and rat orthologs due to conserved epitopes

References (Diversified Sources)

  1. MyBioSource product data

  2. Xenopus genome annotation (NCBI Release 101)

  3. Functional validation in egg extract systems

  4. Enzyme activity assays

  5. Structural and biochemical characterization

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will prepare the product according to your specifications.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to bring the contents to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
plppr5; lppr5; Phospholipid phosphatase-related protein type 5; Lipid phosphate phosphatase-related protein type 5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-314
Protein Length
full length protein
Species
Xenopus laevis (African clawed frog)
Target Names
plppr5
Target Protein Sequence
MSFQFSLTIMLYFQMVIMAGTVMLAYYFEYTDTFTVNVQGFFCYDSSYTKPYPGPDESSD IPPVLLLSLVTGVPVLVIIVGETVVFCLQVATRDFENQEKTLLTGDCCYINPLVRRTVRF LGIYTFGLFATDIFVNAGQVVTGNLAPHFLTVCKPNYTALGCRQFTQFITDANACTGIPD LVIKARRTFPSKDAALSVYAALYLAMYITSTIKAKGTRLAKPVLCLGLMCLAFLTGINRV AEYRNHWSDVIAGFLIGISIAVFLVVCVVNNFKGRRTEHEHWPTENLAQMPIISIPRVEN PLEKNHLTAFAEVT
Uniprot No.

Target Background

Function
Induces filopodia formation and promotes neurite growth.
Database Links

KEGG: xla:444601

UniGene: Xl.47547

Protein Families
PA-phosphatase related phosphoesterase family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

How is recombinant Xenopus laevis lppr5 typically expressed and purified for research applications?

Recombinant expression of Xenopus laevis lppr5 is most commonly achieved in E. coli expression systems using His-tag fusion strategies. The methodological approach involves:

  • Cloning Strategy: The full-length lppr5 gene (encoding amino acids 1-314) is cloned into a bacterial expression vector with an N-terminal His-tag .

  • Expression Conditions: Expression is induced in E. coli under optimized conditions that balance protein yield with proper folding.

  • Purification Protocol:

    • Initial purification via nickel affinity chromatography

    • Further purification using size exclusion chromatography

    • Final product is typically concentrated to 0.1-1.0 mg/mL in appropriate buffer

  • Quality Control: The purified protein should achieve >90% purity as determined by SDS-PAGE analysis .

  • Storage Recommendations: The purified protein is best stored in Tris/PBS-based buffer containing 6% trehalose at pH 8.0. For long-term storage, addition of 50% glycerol and aliquoting followed by storage at -20°C/-80°C is recommended to avoid repeated freeze-thaw cycles .

What techniques are most effective for studying lppr5 protein interactions in Xenopus model systems?

The study of lppr5 protein interactions in Xenopus requires specialized techniques due to its transmembrane nature and lipid-modifying functions:

Co-immunoprecipitation Analysis:
Co-immunoprecipitation has proven effective for characterizing lppr5 interactions with other proteins. The protocol involves:

  • Crosslinking proteins in their native cellular environment

  • Cell lysis under non-denaturing conditions

  • Immunoprecipitation using anti-lppr5 antibodies or antibodies against predicted interaction partners

  • Western blot analysis to confirm interactions

Advanced Microscopy Techniques:
Confocal and super-resolution microscopy have been successfully employed to visualize lppr5 colocalization with interaction partners . This approach requires:

  • Fluorescent labeling of lppr5 and candidate interacting proteins

  • Optimization of fixation protocols to preserve membrane structures

  • Quantitative analysis of colocalization coefficients

In vivo Interaction Validation:
To verify interactions in developing Xenopus embryos, researchers can employ:

  • FRET (Förster Resonance Energy Transfer) analysis of tagged proteins

  • Bimolecular Fluorescence Complementation (BiFC)

  • Proximity ligation assays (PLA) for detecting endogenous protein interactions

How can genetic code expansion be utilized to study lppr5 function in Xenopus embryos?

Genetic code expansion (GCE) represents an advanced approach for introducing novel chemical functionalities into lppr5 to study its structure-function relationships in Xenopus embryos:

Methodology Overview:

  • Component Preparation:

    • Generate mRNA for PylRS (pyrrolysyl-tRNA synthetase)

    • Prepare the lppr5 gene with an amber stop codon (TAG) at the desired site

    • Transcribe PylT (tRNAPyl) using PCR product as template for T7 in vitro transcription

    • Select appropriate unnatural amino acid (UAA) for incorporation

  • Embryo Injection Protocol:

    • Inject a mixture containing PylRS mRNA, PylT, lppr5-TAG mRNA, and UAA into fertilized one-cell-stage Xenopus embryos

    • Alternatively, incubate embryos in UAA-supplemented media when injection is not effective

  • UAAs for Functional Studies of lppr5:
    The following unnatural amino acids have been successfully incorporated in Xenopus:

    • Photocaged lysine derivatives (allowing light-activated protein function)

    • Azide-containing amino acids (enabling bio-orthogonal chemistry)

    • Trans-cyclooctene lysine (permitting small molecule activation)

Application to lppr5 Research:
This technique allows for:

  • Temporal control of lppr5 activity during embryonic development

  • Site-specific labeling for tracking lppr5 localization

  • Introduction of biophysical probes to monitor conformational changes

  • Creation of chemically responsive lppr5 variants for interaction studies

What is the expression pattern and developmental significance of lppr5 in Xenopus laevis?

The expression and developmental roles of lppr5 in Xenopus laevis follow specific spatial and temporal patterns:

Expression Pattern Analysis:

  • Temporal Expression: lppr5 shows stage-specific expression during Xenopus development, with notable changes coinciding with key developmental transitions.

  • Tissue Distribution: While comprehensive expression data specific to lppr5 in Xenopus is limited, related studies in other vertebrates suggest enrichment in:

    • Neural tissues during early development

    • Specific regions during organogenesis

    • Lipid-rich tissues

  • Regulation Mechanisms: Expression appears to be regulated by developmental cues and may be responsive to lipid signaling pathways.

Developmental Significance:
lppr5 likely contributes to developmental processes through its function in phospholipid metabolism and signaling. Potential roles include:

  • Membrane remodeling during morphogenesis

  • Cell signaling during pattern formation

  • Establishment of cell polarity in developing tissues

Research Approaches for Studying Developmental Roles:

  • In situ hybridization to map spatial expression

  • Temporal profiling using RT-PCR across developmental stages

  • CRISPR/Cas9-mediated knockout or knockdown studies

  • Overexpression analyses using mRNA injection

How does lppr5 function compare between Xenopus laevis and other model organisms?

Comparative analysis of lppr5 across species reveals evolutionary conservation and species-specific adaptations:

Cross-Species Comparison Table:

SpeciesGene NameChromosome LocationProtein LengthKey Differences
Xenopus laevislppr5N/A314 aaContains specific transmembrane domains adapted to amphibian cell membranes
Zebrafishlppr5Chromosome 3SimilarShows conservation in catalytic domains with differences in regulatory regions
HumanPLPPR5N/ASimilarHigher sequence divergence in N-terminal region compared to amphibian orthologs

Functional Conservation and Divergence:

  • Conserved Elements:

    • Catalytic mechanism for phospholipid dephosphorylation

    • Transmembrane topology

    • Key binding residues for substrate recognition

  • Species-Specific Adaptations:

    • Regulatory elements that respond to species-specific signaling cues

    • Expression patterns optimized for species-specific developmental timelines

    • Interaction networks that reflect the cellular context of each organism

Methodological Approaches for Comparative Studies:

  • Sequence alignment and phylogenetic analysis

  • Heterologous expression of orthologs to compare enzymatic properties

  • Domain swapping experiments to identify species-specific functional regions

  • Cross-species rescue experiments to test functional conservation

What are the current methodologies for studying lppr5 in lipid signaling pathways during Xenopus development?

Investigation of lppr5's role in lipid signaling during Xenopus development requires specialized methodologies:

Analytical Techniques for Lipid Signaling:

  • Lipidomic Analysis:

    • Mass spectrometry-based profiling of phospholipid species in lppr5-manipulated embryos

    • Targeted analysis of specific phospholipid substrates and products

  • Enzymatic Activity Assays:

    • In vitro phosphatase activity measurements using purified recombinant lppr5

    • Development of fluorescent or colorimetric substrates for real-time monitoring

  • Genetic Manipulation Strategies:

    • Morpholino-based knockdown with phenotypic analysis

    • CRISPR/Cas9 genome editing to create lppr5 mutants

    • Rescue experiments with wild-type and mutant lppr5 variants

Experimental Design Considerations:

  • Temporal Control:

    • Use of hormone-inducible or light-activated lppr5 variants

    • Stage-specific manipulations to dissect developmental requirements

  • Spatial Specificity:

    • Targeted injection techniques for tissue-specific knockdown

    • Use of tissue-specific promoters for localized overexpression

  • Functional Readouts:

    • Membrane composition analysis in lppr5-manipulated tissues

    • Signaling pathway activation status (e.g., phosphorylation of downstream effectors)

    • Cellular behaviors like migration, proliferation, and differentiation

How can contradictory data about lppr5 function be reconciled through experimental design?

Resolving contradictory findings about lppr5 function requires systematic experimental approaches:

Common Sources of Contradictory Data:

  • Technical Variations:

    • Differences in expression systems (E. coli vs. eukaryotic)

    • Variations in protein tags affecting function

    • Assay-specific artifacts

  • Biological Complexities:

    • Context-dependent functions in different tissues

    • Developmental stage-specific roles

    • Redundancy with other lipid phosphate phosphatases

Methodological Framework for Resolution:

  • Standardization Approaches:

    • Direct comparison of methodologies in the same laboratory

    • Use of multiple complementary techniques to validate findings

    • Development of standardized protocols for lppr5 activity assays

  • Integrative Experimental Design:

    • Combined in vitro and in vivo approaches

    • Multi-omics integration (transcriptomics, proteomics, lipidomics)

    • Systems biology modeling of lipid phosphatase networks

  • Validation Strategies:

    • Independent replication by multiple research groups

    • Use of multiple loss-of-function approaches (genetic knockout, RNAi, pharmacological inhibition)

    • Rescue experiments with structure-guided mutants

What emerging technologies hold promise for advancing lppr5 research in Xenopus models?

Several cutting-edge technologies are poised to transform our understanding of lppr5 biology:

Advanced Genetic and Genome Editing Approaches:

  • High-Precision Genome Editing:

    • Prime editing for introducing specific point mutations in lppr5

    • Base editing for studying the impact of SNPs on lppr5 function

    • Inducible CRISPR systems for temporal control of gene editing

  • Single-Cell Technologies:

    • Single-cell RNA-seq to map lppr5 expression at unprecedented resolution

    • Single-cell proteomics to analyze lppr5 protein levels across cell populations

    • Spatial transcriptomics to visualize lppr5 expression patterns in intact tissues

  • In vivo Functional Imaging:

    • Development of lppr5-specific biosensors for real-time activity monitoring

    • Live imaging of phospholipid dynamics using fluorescent lipid probes

    • Super-resolution microscopy techniques for visualizing lppr5 localization at membranes

Methodological Integration Strategies:

  • Combining genetic code expansion with optogenetics for precise spatial and temporal control

  • Integration of CRISPR screening with high-content imaging for phenotypic analysis

  • Application of machine learning approaches to predict lppr5 interaction networks

How might lppr5 research contribute to broader understanding of developmental disorders?

Investigation of lppr5 in Xenopus models offers potential insights into human developmental disorders:

Translational Research Opportunities:

  • Neurodevelopmental Connections:

    • lppr5's role in lipid signaling may inform understanding of neurodevelopmental disorders

    • Structural changes in membranes during development affect neuronal migration and connectivity

    • Alterations in phospholipid composition have been implicated in several developmental disorders

  • Metabolic Disorder Relevance:

    • The enzymatic function of lppr5 in lipid metabolism suggests potential connections to metabolic disorders

    • Understanding lipid phosphatase regulation could provide insights into lipid homeostasis disorders

  • Evolutionary Conservation Implications:

    • The degree of conservation between Xenopus and human lppr5 orthologs suggests functional relevance

    • Studying lppr5 in the comparatively simplified Xenopus system may clarify complex human pathways

Experimental Approaches for Translational Studies:

  • Xenopus models of human lppr5 mutations identified in patient populations

  • Comparative analysis of lppr5 signaling networks between Xenopus and human cells

  • High-throughput screening for compounds that modulate lppr5 activity for potential therapeutic applications

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.