Recombinant Xenopus laevis Lysophospholipid acyltransferase LPCAT4 (lpcat4)

Shipped with Ice Packs
In Stock

Description

General Information

LPCAT4, also known as lysophosphatidylcholine acyltransferase 4, belongs to the 1-acylglycerol-3-phosphate O-acyltransferase family. These enzymes catalyze the conversion of lysophosphatidic acid (LPA) to phosphatidic acid (PA), a precursor in glycerolipid biosynthesis . Both LPA and PA are involved in signal transduction . Xenopus laevis LPCAT4 displays acyl-CoA-dependent lysophospholipid acyltransferase activity with a subset of lysophospholipids as substrates and prefers long-chain acyl-CoAs (C16, C18, etc.) .

Expression and Function

LPCAT4 is expressed in various tissues, with altered expression levels observed in several diseases . Studies show that LPCAT4 is overexpressed in colorectal cancer and hepatocellular carcinoma (HCC) . In HCC, high expression of LPCAT4 is associated with clinicopathological advancements and poor prognoses .

LPCAT4 in Xenopus laevis

Xenopus laevis, the African clawed frog, is a widely used model organism in biological research . Its oocytes provide a convenient expression system for studying receptors, channels, and enzymes . Recombinant Xenopus laevis LPCAT4 is utilized to study its enzymatic activity, substrate specificity, and regulatory mechanisms .

Genetic and Protein Interactions

Interactive genes of LPCATs were investigated using GeneMANIA, and protein–protein interaction (PPI) analysis was conducted using the Search Tool for the Retrieval of Interacting Genes (STRING) . The expression of LPCATs was extensively positively correlated with the infiltration of various stimulatory and suppressive tumor-infiltrating immune cells (TIICs) in the tumor microenvironment .

DNA Methylation

The DNA methylation of LPCAT2/4 was significantly negatively correlated with their expression in HCC . Hypermethylation of numerous CpG sites implied worse survivals of HCC patients .

Table: LPCAT1 Expression in HCC vs. Normal Liver Tissue

Gene NameType of Cancer vs. Normal TissueFold ChangeP valuet-testReference (PMID)
LPCAT1HCC vs. normal liver2.3694.23E-65.32017393520
2.3591.18E-4215.63921159642
2.6763.15E-65.45721159642

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please specify this during your order; we will prioritize fulfilling such requests.
Synonyms
lpcat4; agpat7; aytl3; Lysophospholipid acyltransferase LPCAT4; 1-acylglycerol-3-phosphate O-acyltransferase 7; 1-AGP acyltransferase 7; 1-AGPAT 7; 1-acylglycerophosphocholine O-acyltransferase; 1-acylglycerophosphoserine O-acyltransferase; 1-alkenylglycerophosphoethanolamine O-acyltransferase; 1-alkylglycerophosphocholine O-acetyltransferase; Acyltransferase-like 3; Lysophosphatidylcholine acyltransferase 4; Lysophosphatidylethanolamine acyltransferase 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-522
Protein Length
full length protein
Species
Xenopus laevis (African clawed frog)
Target Names
lpcat4
Target Protein Sequence
MSEADPVGEKGPAEDDGEESVPFNPFLHEFEPKGLWQNARFYILGPILFPLRFLLAAVFL FLMWPIAALRVAGLTDKELSCSIRHRRTILHHLIYLLSRTMFFMCGFHWITIRGRRAPAS EAPILVVAPHSTFFDPIVTVVCDLPSVVSRVENLNIPVIGALLRFNQSILVSRQDPSSRK KVVEEVKRRATSNGEWPQVLFFPEGTNGNGKVLLKFKPGAFVAGVPVQPVLMRYPNKLPA TIWTWKGNGVFKVLWLTMSQFYINLEIEFLPVYHPTAEERADPTLYAFKVQKIMADALAK PATEFELIGDTPVSPLGHLKVALDPKIWELGNILKKAGFSLDSVQGLIDLCLEGVCSRVG LDELAEKLGVTQHDVISRVFNYFNKDAAGMIDFREVSLVLAAQDATRSAEELAKLAFDLF STCDADGRSLLSADGFASVLRSLLGSPPAESGKVFTELYTYTELQGLTQDGFVRFAIRHP CYRHLFLFYLRPPSSGRRKPPQIQQNGGCSGKNNPGKQSKMD
Uniprot No.

Target Background

Function

This recombinant protein exhibits acyl-CoA-dependent lysophospholipid acyltransferase activity with a subset of lysophospholipids as substrates. It preferentially utilizes long-chain acyl-CoAs (C16, C18) as acyl donors.

Database Links

KEGG: xla:446240

UniGene: Xl.32893

Protein Families
1-acyl-sn-glycerol-3-phosphate acyltransferase family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is LPCAT4 and what are its alternative names in scientific literature?

LPCAT4 (lysophospholipid acyltransferase 4) in Xenopus laevis is also known by several alternative names, including agpat7 (1-acylglycerol-3-phosphate O-acyltransferase 7) and aytl3 (acyltransferase-like 3). In some literature, it may also be referred to as lysophosphatidylcholine acyltransferase 4 . The gene nomenclature has evolved over time, with a recent proposal to change the nomenclature to LPLAT10, though this is not yet widely adopted in the literature .

What is the primary biochemical function of LPCAT4?

LPCAT4 functions as an acyl-CoA-dependent lysophospholipid acyltransferase that catalyzes the reacylation of lysophospholipids to generate phospholipids. Based on studies of mammalian homologs, LPCAT4 primarily converts lysophosphatidylcholine (LPC) to phosphatidylcholine (PC), but also has activity toward other lysophospholipid substrates . It shows a preference for long-chain acyl-CoAs (C16, C18) as acyl donors, which contributes to the specific lipid composition of cellular membranes . Unlike some other acyltransferases, LPCAT4 does not display lysophosphatidylinositol, glycerol-3-phosphate, diacylglycerol, or lysophosphatidic acid acyltransferase activity .

How does the expression of LPCAT4 change during cellular differentiation?

Research has shown that LPCAT4 expression is strongly upregulated during cellular differentiation. In urothelial cell differentiation studies, LPCAT4 levels were elevated immediately upon differentiation and remained sustained throughout the differentiation process . This suggests that LPCAT4 plays a critical role in establishing and maintaining the differentiated cell state, likely through regulating membrane lipid composition during this cellular transition.

What expression systems are most effective for producing recombinant Xenopus laevis LPCAT4?

Recombinant Xenopus laevis LPCAT4 can be successfully expressed using several systems, each with distinct advantages depending on research requirements:

  • Cell-Free Expression Systems: Provide rapid protein production without cellular constraints and are suitable for proteins that might be toxic to host cells .

  • E. coli Expression: Cost-effective and scalable, though may require optimization for proper folding of eukaryotic proteins .

  • Yeast Expression: Offers eukaryotic post-translational modifications while maintaining relatively high yields .

  • Baculovirus/Insect Cell Expression: Provides superior eukaryotic protein processing capabilities while maintaining higher yields than mammalian systems .

  • Mammalian Cell Expression: Delivers the most authentic post-translational modifications and protein folding, though at typically lower yields .

For optimal results, purification to ≥85% purity as determined by SDS-PAGE is recommended regardless of the expression system chosen .

What methodological approaches are effective for studying LPCAT4 function in Xenopus systems?

To investigate LPCAT4 function in Xenopus systems, several complementary approaches can be employed:

  • Knockdown Studies: RNA interference (RNAi) or morpholino antisense oligonucleotides can be used to reduce LPCAT4 expression, allowing assessment of its roles in cellular processes .

  • Lipid Profiling: Liquid chromatography coupled with mass spectrometry (LC-MS/MS) provides comprehensive analysis of changes in lipid profiles following LPCAT4 manipulation . This approach can reveal specific substrates and products preferentially affected by LPCAT4 activity.

  • RNA-Seq Analysis: Transcriptomic analysis using RNA-seq can identify gene expression changes resulting from LPCAT4 modulation, providing insights into affected pathways .

  • Cell Culture Assays: Functional assays measuring proliferation rates, cell motility, and barrier function can reveal phenotypic consequences of LPCAT4 manipulation .

  • In vitro Enzymatic Assays: Purified recombinant LPCAT4 can be used in enzyme assays with various lysophospholipid substrates and acyl-CoA donors to determine substrate preferences and kinetic parameters .

How can researchers assess the purity and activity of recombinant LPCAT4?

Assessment of recombinant LPCAT4 purity and activity should involve multiple complementary approaches:

Purity Assessment:

  • SDS-PAGE with Coomassie staining: The standard benchmark is achieving ≥85% purity as determined by densitometric analysis .

  • Western blotting: Using specific antibodies against LPCAT4 or epitope tags (such as Myc/DDK tags if incorporated) to confirm identity .

  • Mass spectrometry: For definitive protein identification and detection of potential modifications or truncations.

Activity Assessment:

  • In vitro acyltransferase assays: Measuring the conversion of lysophospholipids to phospholipids using radiolabeled or fluorescently labeled substrates.

  • LC-MS/MS analysis: Quantifying specific lipid products formed through LPCAT4 activity, particularly focusing on PC 18:1_18:1 molecules which are significantly affected by LPCAT4 activity .

  • Biophysical techniques: Circular dichroism or thermal shift assays to assess proper protein folding.

How does LPCAT4 contribute to membrane dynamics and cellular function?

LPCAT4 plays a multifaceted role in membrane dynamics and cellular function, with knockdown studies revealing several critical contributions:

  • Proliferation and Growth Regulation: LPCAT4 knockdown significantly impairs cellular proliferation rates. In urothelial cell cultures, knockdown of LPCAT4 increased doubling time from 22.3 hours in control cells to 60.3 hours in knockdown cells .

  • Cellular Motility: LPCAT4 appears essential for normal cellular motility, with knockdown cells exhibiting significantly reduced motility compared to control cultures .

  • Barrier Function Modification: Despite impaired proliferation, LPCAT4 knockdown cultures develop elevated trans-epithelial electrical resistances, suggesting compensatory mechanisms in barrier formation .

  • Lipid Composition Regulation: LPCAT4 selectively influences specific lipid species, particularly PC 18:1_18:1 molecules, which are significantly decreased in knockdown cells . This targeted effect on membrane composition likely contributes to the observed functional changes.

  • Gene Expression Modulation: LPCAT4 knockdown affects expression of genes involved in cell adhesion and junction formation, including upregulation of claudins (CLDN1 and CLDN8) and alterations in matrix metallopeptidase regulation .

These findings suggest that LPCAT4 functions as a critical regulator of membrane composition that influences diverse cellular processes beyond simple lipid remodeling.

What is known about the relationship between LPCAT4 and glucose metabolism in Xenopus laevis?

While direct evidence linking LPCAT4 specifically to glucose metabolism in Xenopus laevis is limited, research on related lipid metabolism pathways provides important context. Lysophosphatidic acid (LPA), which involves related lipid metabolism enzymes, stimulates glucose transport in Xenopus laevis oocytes by increasing the Vmax for transport .

This stimulation involves a phosphatidylinositol 3'-kinase-dependent pathway that is pharmacologically distinct from insulin-like growth factor-I (IGF-I) stimulated pathways . LPA with different acyl groups shows varying potencies in stimulating deoxyglucose transport, with a rank order potency of 1-oleoyl-LPA > 1-palmitoyl-LPA > phosphatidic acid = 1-stearoyl-LPA > 1-myristoyl-LPA .

Given LPCAT4's role in phospholipid metabolism and membrane composition, it may indirectly influence glucose transport by affecting membrane properties or signaling pathways. Future research specifically examining LPCAT4's impact on glucose metabolism pathways in Xenopus would help clarify these potential connections.

How do LPCAT4 expression patterns vary across Xenopus tissues and developmental stages?

LPCAT4 shows differential expression patterns across Xenopus tissues, with significant implications for tissue-specific functions. While comprehensive developmental expression data specifically for LPCAT4 in Xenopus is limited in the provided search results, related research on lipid metabolism enzymes provides valuable insights.

In the context of eye development, plasmalogens (Plgs) are highly abundant lipids in the retina, and deficiency in enzymes involved in their synthesis leads to severe abnormalities during eye development . The first acylation step in plasmalogen synthesis involves glyceronephosphate O-acyltransferase (GNPAT), which shares functional similarities with LPCAT4 in terms of acyl transfer mechanisms.

For differentiated tissues like urothelium, LPCAT4 expression is substantially upregulated during differentiation compared to other phospholipid metabolism enzymes . This suggests a crucial role for LPCAT4 in establishing and maintaining differentiated tissue states through specific membrane lipid modifications.

Future research comparing LPCAT4 expression across multiple Xenopus tissues and developmental timepoints would provide valuable insights into tissue-specific functions and developmental regulation of this enzyme.

What are common challenges in expressing and purifying functional recombinant LPCAT4?

Expression and purification of functional recombinant LPCAT4 presents several technical challenges:

  • Membrane Protein Solubilization: As a membrane-associated enzyme, LPCAT4 may have hydrophobic domains that complicate solubilization and purification. Optimizing detergent types and concentrations is crucial for maintaining native conformation while extracting the protein.

  • Expression System Selection: Different expression systems yield varying results for LPCAT4. While E. coli systems are cost-effective, they may not provide proper folding or post-translational modifications. Eukaryotic systems (yeast, insect, or mammalian cells) often provide better functional yields but at higher cost and complexity .

  • Activity Preservation: Maintaining enzymatic activity throughout purification requires careful buffer optimization. Storage buffers typically containing 25 mM Tris-HCl (pH 7.3), 100 mM glycine, and 10% glycerol help stabilize the protein .

  • Protein Stability: Recombinant LPCAT4 may show reduced stability during storage. Proper storage at -80°C and avoiding repeated freeze-thaw cycles are essential for maintaining activity .

  • Purity Assessment: Achieving ≥85% purity as determined by SDS-PAGE is the standard benchmark, but additional methods like Western blotting or mass spectrometry may be needed to confirm identity and homogeneity .

How can researchers effectively design LPCAT4 knockdown experiments?

Designing effective LPCAT4 knockdown experiments requires careful consideration of several methodological aspects:

  • Knockdown Method Selection:

    • shRNA approaches provide stable, long-term knockdown suitable for studying differentiation and development processes .

    • siRNA offers transient knockdown with potentially fewer off-target effects.

    • CRISPR-Cas9 can provide complete knockout but may be lethal if LPCAT4 is essential.

  • Validation Approaches:

    • RT-qPCR to confirm reduced LPCAT4 mRNA levels.

    • Western blotting to verify protein reduction.

    • LC-MS/MS to confirm functional impact on lipid composition, specifically looking for reduction in PC 18:1_18:1 molecules .

  • Control Selection:

    • Non-targeting shRNA/siRNA controls should be carefully matched for GC content and sequence length.

    • Multiple independent shRNA/siRNA sequences targeting different regions of LPCAT4 should be tested to confirm phenotype specificity.

  • Phenotypic Analysis Timeline:

    • Growth rate analysis should extend beyond 60 hours to capture full proliferation dynamics .

    • Differentiation studies should include both early (48h) and late (144h) timepoints to distinguish initial and compensatory effects .

  • Rescue Experiments:

    • Expression of shRNA-resistant LPCAT4 constructs can confirm specificity of observed phenotypes.

    • Structure-function studies using point mutants can identify critical catalytic residues.

What analytical methods provide the most comprehensive assessment of LPCAT4's impact on lipid profiles?

For comprehensive assessment of LPCAT4's impact on lipid profiles, researchers should consider a multi-faceted analytical approach:

What are the implications of LPCAT4 research for understanding lipid-associated pathologies?

Research on LPCAT4 has significant implications for understanding lipid-associated pathologies across multiple systems:

  • Barrier Tissue Dysfunction: LPCAT4 knockdown alters barrier integrity and cellular behavior in epithelial models, suggesting its potential role in barrier tissue pathologies such as inflammatory bowel disease, atopic dermatitis, or interstitial cystitis .

  • Cellular Proliferation Disorders: The significant impact of LPCAT4 on cellular proliferation rates (with knockdown increasing doubling time from 22.3 to 60.3 hours) suggests potential roles in hyperproliferative conditions or cancer biology .

  • Developmental Disorders: Given the importance of precise lipid composition in development, particularly in tissues like the eye where plasmalogens and related lipids are critical, LPCAT4 dysfunction could contribute to developmental abnormalities .

  • Metabolic Disorders: The potential connections between LPCAT4 activity and glucose metabolism pathways suggest implications for metabolic disorders, particularly those involving altered cellular energy utilization .

  • Membrane Dynamics in Disease: The specific reduction in PC 18:1_18:1 molecules following LPCAT4 knockdown highlights how discrete changes in membrane composition might contribute to disease states through altered membrane fluidity or signaling platform function .

How might LPCAT4 function differ between Xenopus laevis and other model organisms?

LPCAT4 function shows both conservation and divergence between Xenopus laevis and other model organisms:

  • Substrate Preference Conservation: The preference for long-chain acyl-CoAs (C16, C18) as acyl donors appears conserved between Xenopus and mammalian LPCAT4 homologs, suggesting fundamental conservation of catalytic mechanisms .

  • Developmental Context Differences: Xenopus laevis lacks certain lipid signaling components present in mammals, such as the critical sperm factor PLCζ, suggesting potential compensatory roles for other lipid metabolism enzymes including LPCAT4 .

  • Expression Pattern Variations: The expression patterns of phospholipid metabolism genes show species-specific variations. For example, in mouse testis, Plcz1 is the most abundant transcript followed by Plcd4, while Xenopus lacks PLCZ1 and shows higher expression of plcd4 , suggesting potentially different regulatory networks for lipid metabolism enzymes including LPCAT4.

  • Tissue-Specific Functions: The differential expression of LPCAT4 across tissues may reflect species-specific adaptations. In Xenopus eye development, specialized lipid metabolism involving acyltransferases plays critical roles that may differ from mammalian systems .

  • Evolutionary Adaptations: The absence of certain lipid signaling components in Xenopus raises questions about how fertilization triggers calcium release and egg activation without these factors, potentially highlighting compensatory roles for enzymes like LPCAT4 in evolutionary adaptations .

What novel experimental approaches could advance our understanding of LPCAT4 in Xenopus systems?

Several innovative experimental approaches could significantly advance our understanding of LPCAT4 in Xenopus systems:

  • CRISPR-Cas9 Genome Editing: Generation of LPCAT4 knockout or knock-in Xenopus models would allow detailed analysis of developmental and physiological roles. This could include introduction of fluorescent tags for live imaging or specific mutations to probe structure-function relationships.

  • Single-Cell Omics Integration: Combining single-cell RNA-seq with lipidomics could reveal cell type-specific roles of LPCAT4 during development and tissue differentiation, particularly in tissues with complex cellular composition like the retina .

  • In vivo Lipid Imaging: Development of fluorescent lipid analogs that specifically track LPCAT4 activity in live Xenopus embryos would provide dynamic visualization of enzyme activity during development.

  • Organoid Models: Establishing Xenopus organoid culture systems would enable detailed analysis of LPCAT4's role in tissue-specific differentiation and function under controlled conditions.

  • Comparative Interactomics: Proteomic analysis of LPCAT4 interacting partners across different tissues and developmental stages could identify tissue-specific regulatory mechanisms and functional complexes.

  • Multi-omics Data Integration: Integrating transcriptomics, proteomics, and lipidomics data from LPCAT4-manipulated systems would provide comprehensive insights into the enzyme's role in cellular homeostasis and adaptation.

These approaches, particularly when combined, have the potential to reveal novel aspects of LPCAT4 biology in Xenopus systems and provide insights with broader relevance to lipid metabolism across species.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.