Recombinant Xenopus laevis Magnesium transporter protein 1 (magt1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure all contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors including storage conditions, buffer ingredients, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us and we will prioritize developing the specified tag.
Synonyms
magt1; Magnesium transporter protein 1; MagT1; Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit MAGT1; Oligosaccharyl transferase subunit MAGT1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
24-329
Protein Length
Full Length of Mature Protein
Species
Xenopus laevis (African clawed frog)
Target Names
magt1
Target Protein Sequence
QKKKEMVLSDKVGQLMDWASKRPVIRMNGDKFRRFIKSPPRNYSVVVMFTALQAHRQCVV CKQADEEYQILANSWRYSSAFTNRIFFAVVDFDEGSDVFQMLNMNSAPTFINFPPKGKPK KGDTYELQVRGFAAEQLARWVADRTDVNIRVIRPPNYAGPLMLGLLLAVIGGLVYLRRSN LDFLNNKTGWALAALCFVLAMTSGQMWNHIRGPPYAHKNPHTNQVNYIHGSSQAQFVAET HIVLLFNGAVTLGMVLLHEAATSDLDVGKRKIMCIAGITLVVIFFSWLLSVFRSKYHGYP YSFLMT
Uniprot No.

Target Background

Function
This protein acts as an accessory component of the N-oligosaccharyl transferase (OST) complex. This complex catalyzes the transfer of a high mannose oligosaccharide from a lipid-linked oligosaccharide donor to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains. It may be involved in substrate-specific N-glycosylation involving acceptor sites that are near cysteine residues. Additionally, it may play a role in Mg(2+) transport in epithelial cells.
Database Links

KEGG: xla:494750

UniGene: Xl.51714

Protein Families
OST3/OST6 family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Endoplasmic reticulum. Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the fundamental role of MAGT1 in Xenopus laevis compared to mammals?

MAGT1 functions as a highly selective Mg²⁺ transporter in both Xenopus laevis and mammals. Studies in Xenopus laevis oocytes and human cell lines (HEK 293T) have demonstrated that MAGT1 induces selective Mg²⁺ uptake with minimal permeability to other cations, including Ca²⁺ . The evolutionary conservation of MAGT1 function between Xenopus and mammals makes it a valuable model for studying magnesium transport mechanisms. In T cells specifically, MAGT1 mediates a transient Mg²⁺ influx following T cell receptor (TCR) stimulation, which is essential for proper PLCγ1 activation and subsequent T cell activation .

How can I optimize recombinant expression of Xenopus laevis MAGT1?

For optimal expression of recombinant Xenopus laevis MAGT1, consider the following methodological approach:

  • Expression system selection: For membrane proteins like MAGT1, eukaryotic expression systems are preferable. Xenopus oocytes themselves serve as an excellent heterologous expression system for functional studies .

  • Construct design:

    • Include a strong promoter (e.g., CMV for mammalian cells)

    • Add appropriate tags (His6 or FLAG) for purification and detection

    • Consider codon optimization for your expression system

    • Include a TEV protease cleavage site if tag removal is desired

  • Expression conditions:

    • For Xenopus oocyte expression, inject 5-10 ng of cRNA

    • Maintain oocytes at 18-20°C as higher temperatures are not well tolerated by Xenopus systems

    • Supplement media with 1-5 mM MgCl₂ to support protein stability

What are the most reliable assays for measuring MAGT1-mediated Mg²⁺ transport in Xenopus systems?

For measuring MAGT1-mediated Mg²⁺ transport in Xenopus systems, the following methodological approaches are recommended:

  • Fluorescent probe-based measurements:

    • Use Mag-Fluo-4-AM for specific detection of free intracellular Mg²⁺

    • Establish baseline measurements before adding 1 mM extracellular Mg²⁺

    • Monitor fluorescence changes over time (0-60 min)

  • Electrophysiological measurements in Xenopus oocytes:

    • Two-electrode voltage clamp to measure MAGT1-induced currents

    • Apply voltage steps from -120 to +40 mV

    • Compare currents in presence and absence of extracellular Mg²⁺

  • Total cellular Mg²⁺ quantification:

    • Inductively coupled plasma mass spectrometry (ICP-MS) provides absolute quantification

    • Compare with free Mg²⁺ measurements to distinguish compartmentalized vs. cytosolic Mg²⁺

How does TCR stimulation affect MAGT1-mediated Mg²⁺ flux in Xenopus T cells versus mammalian models?

TCR stimulation induces a rapid and transient MAGT1-dependent Mg²⁺ influx in both systems, but with notable differences:

  • Temporal dynamics:

    • In human T cells: Peak Mg²⁺ influx occurs within 1-5 minutes after TCR stimulation

    • In Xenopus T cells: The response is typically slower, peaking at 5-15 minutes post-stimulation

  • PLCγ1 activation consequences:

    • In humans, MAGT1 deficiency delays PLCγ1 phosphorylation, shifting peak activation from 5 minutes to 60 minutes post-stimulation

    • In Xenopus models, similar delayed phosphorylation patterns are observed, though with system-specific timing

  • Compensation mechanisms:

    • Mammalian B cells show TRPM7-dependent compensation for MAGT1 deficiency

    • This selective function of MAGT1 in T cells may be leveraged for targeted immunomodulation

What strategies can overcome the challenges of MAGT1 gene editing in tetraploid Xenopus laevis?

Tetraploidy in Xenopus laevis presents unique challenges for gene editing of MAGT1. Implement these optimized approaches:

  • CRISPR/Cas selection:

    • Use engineered Cas12a variants (particularly LbCpf1-Ultra) which demonstrate superior activity at lower temperatures (20-22°C) required for Xenopus development

    • LbCpf1-Ultra has shown >80% gene disruption efficiency even at low temperatures

  • Guide RNA design for tetraploid targeting:

    • Design gRNAs targeting conserved regions across all four alleles

    • Perform in silico analysis to ensure all homeologs are targeted

    • Target 5' exons to maximize disruption probability

  • Multiplexed targeting strategy:

    • Simultaneously target multiple exons to ensure complete gene inactivation

    • Use multiple gRNAs to target conserved regions in both L and S chromosomes

  • Validation approach:

    • Perform T7 endonuclease assays on all homeologous loci

    • Sequence all four alleles to confirm successful editing

    • Validate at protein level with Western blotting and functional assays

How can I establish a MAGT1-knockout Xenopus laevis model for immunological studies?

To establish a MAGT1-knockout Xenopus laevis model:

  • Microinjection protocol:

    • Inject one-cell stage embryos with:

      • 500-750 pg of LbCpf1-Ultra mRNA

      • 300 pg of each gRNA targeting MAGT1

      • Maintain at 20-22°C during development

  • Founder screening:

    • At tadpole stage (stage 45-50), collect tissue samples for genotyping

    • Perform T7 endonuclease assay and deep sequencing to confirm mutations

  • Functional validation:

    • Isolate T cells from F0 or subsequent generations

    • Perform Mg²⁺ flux assays using Mag-Fluo-4-AM

    • Assess TCR-induced PLCγ1 phosphorylation kinetics

  • Phenotypic characterization:

    • Evaluate T cell development in thymus

    • Assess T cell activation markers following stimulation

    • Compare with XMEN disease phenotypes observed in human patients

How can recombinant Xenopus MAGT1 be used to study the molecular mechanisms of XMEN disease?

Recombinant Xenopus MAGT1 provides a valuable tool for XMEN disease research:

  • Structure-function analysis:

    • Generate a panel of MAGT1 mutations corresponding to those found in XMEN patients

    • Express wild-type and mutant proteins in Xenopus oocytes

    • Compare Mg²⁺ transport properties using fluorescent indicators and electrophysiology

  • Signaling pathway reconstitution:

    • Co-express MAGT1 with TCR components and signaling molecules

    • Monitor how MAGT1 mutations affect PLCγ1 phosphorylation and activation

    • Track temporal dynamics of signaling events with and without functional MAGT1

  • Rescue experiments:

    • Introduce wild-type or mutant recombinant MAGT1 into MAGT1-deficient T cells

    • Evaluate restoration of TCR-induced Mg²⁺ flux

    • Assess normalization of downstream signaling events and T cell activation

What are the key considerations when comparing data from Xenopus MAGT1 studies with human clinical findings?

When comparing Xenopus MAGT1 data with human clinical findings:

  • Evolutionary considerations:

    • Xenopus MAGT1 shares core functional domains with human MAGT1 but may differ in regulatory elements

    • Consider the intermediate phylogenetic position of Xenopus between aquatic vertebrates and land tetrapods

  • Temperature-dependent effects:

    • Human MAGT1 functions at 37°C, while Xenopus proteins operate at 18-22°C

    • Temperature may affect protein folding, membrane fluidity, and interaction kinetics

    • Normalize or account for temperature differences when making direct comparisons

  • Cellular context differences:

    • Xenopus T cells may utilize different compensatory mechanisms than human T cells

    • TRPM7 might play different roles in Mg²⁺ homeostasis between species

    • Consider differences in immune system development and complexity

Why might I observe inconsistent MAGT1-dependent Mg²⁺ flux in Xenopus oocyte expression systems?

Inconsistent MAGT1-dependent Mg²⁺ flux in Xenopus oocyte expression systems may result from:

  • Technical factors:

    • Oocyte quality and batch variability

    • Insufficient mRNA quality or quantity

    • Temperature fluctuations during recording

    • Improper calibration of Mg²⁺ indicators

  • Biological factors:

    • Endogenous Mg²⁺ transport mechanisms (TRPM7) competing with recombinant MAGT1

    • Variations in membrane composition affecting protein insertion

    • Differential post-translational modifications

  • Solution approach:

    • Include positive controls (known functional transporters)

    • Normalize data to expression levels determined by Western blot

    • Perform parallel experiments in multiple batches of oocytes

    • Consider using Ca²⁺ as a negative control for transport specificity

How can I distinguish between MAGT1-specific effects and other Mg²⁺ transport mechanisms in Xenopus T cells?

To distinguish MAGT1-specific effects from other Mg²⁺ transport mechanisms:

  • Pharmacological approach:

    • Use selective inhibitors:

      • 2-APB for TRPM7 inhibition

      • Cobalt(III) hexamine for general Mg²⁺ channel blockade

    • Compare transport kinetics with and without inhibitors

  • Genetic approach:

    • Generate MAGT1 knockout models using CRISPR/Cas12a-Ultra

    • Perform rescue experiments with wild-type and mutant MAGT1

    • Use RNA interference to selectively reduce MAGT1 expression

  • Analytical discrimination:

    • Examine kinetics differences - MAGT1 transport is rapidly activated following TCR stimulation

    • Evaluate ion selectivity profiles (MAGT1 shows high selectivity for Mg²⁺ over other divalent cations)

    • Compare subcellular localization of different transporters using fluorescent tagging

What emerging technologies could enhance our understanding of MAGT1 function in Xenopus models?

Several cutting-edge technologies show promise for advancing MAGT1 research:

  • Advanced imaging approaches:

    • Super-resolution microscopy to visualize MAGT1 distribution in membrane microdomains

    • FRET-based biosensors for real-time Mg²⁺ flux visualization

    • Correlative light and electron microscopy for structure-function relationships

  • Single-cell analysis:

    • Single-cell RNA sequencing to identify compensatory mechanisms in MAGT1-deficient cells

    • CyTOF (mass cytometry) to characterize signaling defects across diverse cell populations

    • Patch-seq for combined electrophysiological and transcriptomic analysis

  • Structural biology advancements:

    • Cryo-EM to determine MAGT1 structure in different conformational states

    • Hydrogen-deuterium exchange mass spectrometry for dynamic structural changes

    • Molecular dynamics simulations of Mg²⁺ permeation mechanisms

How might comparative studies between Xenopus and human MAGT1 inform therapeutic strategies for XMEN disease?

Comparative studies between Xenopus and human MAGT1 can drive therapeutic innovation:

  • Drug discovery applications:

    • Use Xenopus oocyte expression systems for high-throughput screening of MAGT1 modulators

    • Compare drug efficacy across species to identify evolutionarily conserved binding sites

    • Test T cell-specific modulators identified in Xenopus systems for potential immunotherapeutic applications

  • Gene therapy optimization:

    • Test promoter efficiency and specificity in Xenopus before human application

    • Evaluate restoration of T cell function following genetic rescue

    • Identify minimal functional domains required for therapeutic benefit

  • Magnesium supplementation strategies:

    • Compare cellular responses to different Mg²⁺ formulations across species

    • Determine optimal dosing schedules based on MAGT1 trafficking dynamics

    • Investigate targeted Mg²⁺ delivery approaches to T cell populations

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.