Recombinant Xenopus laevis Melanopsin-B (opn4b)

Shipped with Ice Packs
In Stock

Description

Circadian Rhythm Regulation

Recombinant opn4b is used to study melanopsin’s role in synchronizing circadian clocks. In X. laevis, melanopsin-B in ipHCs and ipRGCs regulates neuroendocrine pathways that modulate skin pigmentation via α-melanocyte-stimulating hormone (α-MSH) .

Photosensitive Signaling Pathways

The protein enables dissection of G-protein-coupled signaling cascades. For example:

  • Activation of phospholipase C (PLC) via Gαq/11 subunits .

  • Calcium influx studies using HEK293 cells transfected with recombinant opn4b .

Evolutionary Comparisons

Comparative studies highlight species-specific adaptations:

  • Mammals retain only opn4 (lost opn4b), while amphibians and teleosts preserve both paralogs .

  • Zebrafish opn4b shares 62% amino acid identity with X. laevis opn4b, suggesting conserved functional domains .

Expression and Purification Workflow

StepProtocol
Gene CloningFull-length opn4b cDNA cloned into pET-28a(+) vector
Bacterial ExpressionInduced with IPTG in E. coli BL21(DE3) at 18°C for 20 hrs
PurificationNi-NTA affinity chromatography under denaturing conditions
ReconstitutionSolubilized in 0.1-1.0 mg/mL with glycerol (5-50%) for stability

Key Research Findings

  • Developmental Onset: opn4b mRNA emerges at stage 37/38 in X. laevis retina, coinciding with functional retinal circuitry .

  • Light-Activated Pathways: Over 60% of opn4b-expressing cells show c-fos induction under light stimulation, confirming integration into phototransduction networks .

  • Skin Pigmentation: Blocking light to the pineal complex (expressing opn4b) disrupts melanosome dispersion in tadpoles, validating its role in rapid physiological responses .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery estimates.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
opn4b; mop; Melanopsin-B; Opsin-4B; xMOP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-534
Protein Length
full length protein
Species
Xenopus laevis (African clawed frog)
Target Names
opn4b
Target Protein Sequence
MDLGKTVEYGTHRQDAIAQIDVPDQVLYTIGSFILIIGSVGIIGNMLVLYAFYRNKKLRT APNYFIINLAISDFLMSATQAPVCFLSSLHREWILGDIGCNVYAFCGALFGITSMMTLLA ISINRYIVITKPLQSIQWSSKKRTSQIIVLVWMYSLMWSLAPLLGWSSYVPEGLRISCTW DYVTSTMSNRSYTMMLCCCVFFIPLIVISHCYLFMFLAIRSTGRNVQKLGSYGRQSFLSQ SMKNEWKMAKIAFVIIIVFVLSWSPYACVTLIAWAGHGKSLTPYSKTVPAVIAKASAIYN PIIYGIIHPKYRETIHKTVPCLRFLIREPKKDIFESSVRGSIYGRQSASRKKNSFISTVS TAETVSSHIWDNTPNGHWDRKSLSQTMSNLCSPLLQDPNSSHTLEQTLTWPDDPSPKEIL LPSSLKSVTYPIGLESIVKDEHTNNSCVRNHRVDKSGGLDWIINATLPRIVIIPTSESNI SETKEEHDNNSEEKSKRTEEEEDFFNFHVDTSLLNLEGLNSSTDLYEVVERFLS
Uniprot No.

Target Background

Function
Melanopsin-B (opn4b) is a photoreceptor involved in non-image-forming responses to light. It may have the ability to isomerize covalently bound all-trans retinal back to 11-cis retinal.
Database Links

KEGG: xla:373689

UniGene: Xl.310

Protein Families
G-protein coupled receptor 1 family, Opsin subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Highest level in the iris, high level in the inner nuclear layer, possibly in horizontal cells, and lowest level in retinal pigment epithelium. Expressed in melanophore cells of the skin.

Q&A

What is Melanopsin-B (opn4b) and how does it differ from other melanopsins in Xenopus laevis?

Melanopsin-B (opn4b) is one of the melanopsin variants in Xenopus laevis. In this amphibian model, melanopsins include opn4 (mammalian-like or opn4m) and opn4a (Xenopus-like or opn4x). These photosensitive pigments belong to the broader family of type-II opsins. The melanopsins in Xenopus laevis are expressed in horizontal cells (HCs) and retinal ganglion cells (RGCs), with approximately 91% colocalization between opn4 and opn4a . Unlike classical visual opsins (rhodopsin and cone opsins), melanopsins mediate non-image-forming visual functions and exhibit signal transduction pathways more closely resembling those of invertebrate photoreceptors than vertebrate rod and cone cells .

What are the known cellular expression patterns of opn4b in Xenopus laevis retina?

In the Xenopus laevis retina, melanopsins (opn4/opn4a family) are predominantly expressed in a subset of horizontal cells (HCs) and retinal ganglion cells (RGCs) . While the specific expression pattern of opn4b has not been directly addressed in the provided research, studies have demonstrated that melanopsin-expressing retinal ganglion cells (mRGCs) constitute a distinct population from those expressing other neuropsins like opn5 and opn8. In particular, melanopsin-expressing cells in the inner nuclear layer (INL) show limited overlap with opn5-expressing cells (approximately 24% co-expression) . This differential expression pattern suggests specialized functions for the various photosensitive cells in the Xenopus retina.

What is the developmental timeline for opn4b expression in Xenopus laevis?

The developmental timeline of melanopsin expression in Xenopus laevis follows a well-defined pattern coordinated with retinal circuit formation. While specific opn4b developmental data is not explicitly mentioned in the provided sources, related melanopsins (opn4/opn4a) expression has been characterized. For context, neuropsins like opn5 and opn8 begin expression at stage 37/38, coinciding with the initial activation of retinal circuits. In contrast, opn6a and opn6b emerge earlier at stage 35 in newborn photoreceptors . Given that melanopsins are functionally active in the mature Xenopus retina, researchers should examine opn4b expression from early embryonic stages (pre-stage 35) through larval development to metamorphosis to understand its complete developmental profile.

What are the optimal methods for generating recombinant Xenopus laevis Melanopsin-B (opn4b)?

For generating recombinant Xenopus laevis Melanopsin-B (opn4b), researchers should follow these methodological steps:

  • Gene Identification and Cloning: Use genomic databases to identify the complete opn4b sequence in Xenopus laevis. Unlike many histone genes, opsin genes typically contain introns that should be considered during the cloning process .

  • Expression Vector Construction: Design specific primers targeting the opn4b coding sequence. Clone the amplified sequence into an appropriate expression vector containing a strong promoter (e.g., CMV) and fusion tags for detection and purification.

  • Heterologous Expression Systems:

    • Cell Culture Expression: Transfect mammalian cell lines (HEK293, COS-7) or amphibian cell lines with the expression construct.

    • Xenopus Oocyte Expression: Inject in vitro transcribed opn4b mRNA into Xenopus oocytes, which serve as an excellent single-cell expression system for studying membrane proteins .

  • Reconstitution with 11-cis-retinal: For functional studies, reconstitute the expressed protein with 11-cis-retinal chromophore, as previous studies indicate that melanopsin photoresponses in Xenopus melanophores depend on retinaldehyde .

  • Verification of Expression: Confirm successful expression using Western blotting and immunofluorescence with antibodies against the fusion tag or melanopsin.

What in situ hybridization techniques are most effective for detecting opn4b transcripts in Xenopus retinal tissue?

For optimal detection of opn4b transcripts in Xenopus retinal tissue, the following in situ hybridization techniques are recommended:

  • Probe Design: Synthesize antisense RNA probes specific to Xenopus laevis opn4b, avoiding cross-reactivity with other opsin genes. Design probes that target unique regions to distinguish between opn4b and other melanopsin variants.

  • Fluorescent In Situ Hybridization (FISH): For detecting co-expression with other opsins, employ double FISH using differentially labeled probes. This approach has been successfully used to demonstrate that approximately 24% of opn5-positive cells co-express opn4a in the inner nuclear layer .

  • Tissue Preparation: For developmental studies, fix embryos at various stages (35-44) using 4% paraformaldehyde. For adult retinas, use fresh-frozen or fixed cryosections.

  • Visualization:

    • For co-localization studies, combine FISH with immunohistochemistry using antibodies against cell-type-specific markers.

    • For activity studies, pair FISH detection of opn4b with immediate early gene markers like c-fos to identify light-responsive cells .

  • Controls: Include sense probes as negative controls and probes for well-characterized opsins (rhodopsin) as positive controls.

This combined approach allows for precise cellular and subcellular localization of opn4b transcripts and comparison with other photosensitive molecules in the retina.

How can researchers reliably assess the functional activity of recombinant opn4b in experimental systems?

To reliably assess the functional activity of recombinant opn4b, researchers can employ multiple complementary approaches:

  • Spectral Sensitivity Profiling:

    • Determine the action spectrum using narrow-band light sources (440-500 nm range) with precise irradiance control.

    • Melanopsin in Xenopus melanophores shows maximal response between 450-470 nm .

  • Electrophysiological Recordings:

    • Whole-cell patch-clamp recording in heterologous expression systems.

    • Two-electrode voltage clamp in Xenopus oocytes expressing recombinant opn4b.

    • Monitor light-induced currents and membrane potential changes.

  • Calcium Imaging:

    • Co-express opn4b with genetically encoded calcium indicators.

    • Record light-induced calcium transients using fluorescence microscopy.

  • Biochemical Signaling Assays:

    • Measure light-dependent changes in second messenger levels (particularly cGMP which shows 4-fold increase after illumination in melanopsin pathways) .

    • Assess protein phosphorylation status of downstream targets.

  • Functional Cellular Assays:

    • In melanophores, quantify melanosome dispersion using the melanophore index or automated image analysis.

    • Determine EI50 values (half-maximal effective irradiance, reported as 20.82 × 102 μW/cm2 for native melanopsin responses) .

  • Inhibitor Studies:

    • Use specific pathway inhibitors to determine signaling mechanisms.

    • Differentiate between Gq/11 (PLC/IP3/Ca2+) and Gi/o (cGMP) pathways.

By combining these methodologies, researchers can comprehensively characterize the spectral, temporal, and signaling properties of recombinant opn4b.

What signaling pathway does Xenopus laevis opn4b utilize and how does it compare to other opsins?

Xenopus laevis melanopsin utilizes a distinctive signaling pathway that shares characteristics with invertebrate photoreceptors rather than vertebrate rod and cone cells:

  • cGMP Signaling:

    • Light stimulation triggers a 4-fold increase in intracellular cGMP levels, unlike the light-induced decrease observed in rod and cone photoreceptors .

    • This cGMP elevation pattern resembles signaling in scallop photoreceptors and reptilian parietal eyes .

  • G-protein Coupling:

    • Evidence suggests melanopsin couples to G-proteins distinct from the Gt (transducin) used by visual opsins.

    • The activation likely involves Gq/11 and/or Gi/o pathways.

  • Downstream Effectors:

    • While PKG (protein kinase G) inhibitors only mildly affect the light response, the involvement of cGMP suggests partial dependence on this pathway .

    • The light response does not appear to be mediated by 8-bromo cGMP (a cell-permeable cGMP analogue) .

  • Cellular Response:

    • In melanophores, the final cellular response is melanosome dispersion, with spectral sensitivity peaking between 450-470 nm .

  • Comparative Analysis:

Opsin TypeLight Effect on cGMPCellular ResponseG-protein Coupling
Rod/Cone OpsinsDecreaseHyperpolarizationGt (transducin)
MelanopsinIncreaseVaries by cell typeLikely Gq/11 and/or Gi/o
Scallop OpsinsIncreaseK+ inward currentGo
Reptile Parietal EyeIncreaseNa+ channel openingUnknown

This distinctive signaling profile positions melanopsin as phylogenetically intermediate between typical vertebrate and invertebrate photoreceptive systems .

How do the spectral properties of recombinant opn4b compare with native melanopsin and other opsins in Xenopus laevis?

The spectral properties of melanopsin in Xenopus laevis show distinctive characteristics:

  • Absorption Maximum:

    • Native melanopsin in Xenopus melanophores exhibits a spectral maximal response between 450-470 nm .

    • This blue-light sensitivity differs from the absorption maxima of classical visual opsins in Xenopus: rods (502 nm) and the various cone types (blue, green, and red sensitive).

  • Chromophore Interaction:

    • Like other opsins, melanopsin function depends on retinaldehyde as a chromophore .

    • The specific isomer preference (11-cis vs. all-trans) and regeneration mechanisms may differ from visual opsins.

  • Photosensitivity:

    • The half-maximal effective irradiance (EI50) for native melanopsin response is approximately 20.82 × 102 μW/cm2 .

    • This sensitivity is generally lower than that of classical visual opsins but appropriate for non-image-forming functions.

When expressing recombinant opn4b, researchers should verify whether the spectral properties match these native characteristics or show variations that might indicate functional specialization within the melanopsin family.

What are the evolutionary implications of opn4b conservation across species compared to other melanopsin variants?

The evolutionary analysis of opn4b conservation across species reveals important insights into photoreceptor evolution:

  • Phylogenetic Distribution:

    • Melanopsin variants show differential conservation across vertebrate lineages.

    • While specific opn4b conservation data isn't directly provided in the sources, comparative analysis with other neuropsins shows significant evolutionary diversification.

  • Functional Divergence:

    • Different vertebrate lineages show specialization in neuropsin expression patterns. For example, in zebrafish, opn6a and opn6b are expressed in photoreceptors, while Müller glia and amacrine cells express opn8c .

    • These differences suggest adaptive evolution of photoreception mechanisms across vertebrate lineages.

  • Signaling Pathway Conservation:

    • The melanopsin signaling pathway in Xenopus shares characteristics with invertebrate photoreceptors, suggesting ancient evolutionary origins .

    • This invertebrate-like signaling (cGMP increase upon light stimulation) contrasts with the vertebrate visual opsins, placing melanopsins at a fascinating evolutionary junction.

  • Cell-Type Expression Evolution:

    • The expression of melanopsins in horizontal cells and retinal ganglion cells in Xenopus represents a specialized adaptation .

    • Comparing this expression pattern across species can reveal the evolutionary trajectory of non-image-forming photoreception.

These evolutionary considerations suggest that opn4b may represent an important link in understanding the transition between invertebrate and vertebrate photoreceptive systems and the diversification of non-image-forming light detection mechanisms.

How might opn4b contribute to non-visual photoreception during Xenopus metamorphosis?

Melanopsin-B (opn4b) likely plays significant roles during the dramatic metamorphosis of Xenopus laevis, particularly in adapting non-visual photoreception to changing ecological niches:

  • Developmental Transition in Locomotion:

    • Xenopus undergoes a fundamental shift from tail-based swimming in larvae to limb-based locomotion in adults .

    • This transition requires corresponding adaptations in visuomotor circuits that may involve melanopsin-mediated light detection.

  • Retinal Circuit Remodeling:

    • During metamorphosis, retinal circuits undergo extensive remodeling.

    • Melanopsin-expressing cells might participate in this remodeling process, potentially serving as stabilizing elements during reorganization.

  • Changing Photoenvironments:

    • The transition from aquatic to semi-terrestrial lifestyle involves exposure to different light environments.

    • Melanopsin's blue-light sensitivity (450-470 nm) may be particularly important for detecting specific wavelengths that penetrate water versus air.

  • Circadian and Neuroendocrine Adaptation:

    • Metamorphosis involves significant changes in circadian rhythms and neuroendocrine signaling.

    • Melanopsin-mediated non-visual photoreception may coordinate these physiological adaptations with environmental light cues.

  • Integrative Sensory Processing:

    • Evidence from Xenopus shows that "predictive feed-forward signaling from the spinal locomotor pattern generator are engaged in minimizing visual disturbances during tail-based swimming" .

    • As locomotion transitions from tail to limb-based, the integration between melanopsin-mediated photoreception and motor control may require significant reconfiguration.

Understanding opn4b's role during metamorphosis could provide fundamental insights into how sensory systems adapt to changing locomotor strategies and environmental niches.

What experimental approaches can resolve contradictory data regarding opn4b signal transduction mechanisms?

To resolve contradictions in opn4b signal transduction mechanisms, researchers should implement multi-faceted experimental strategies:

  • Comprehensive Pathway Dissection:

    • Parallel Pathway Analysis: Simultaneously measure multiple second messengers (cGMP, cAMP, IP3, Ca2+) following light stimulation to detect potential bifurcating pathways.

    • Temporal Resolution: Use high-temporal resolution techniques to distinguish primary from secondary signaling events.

    • Specific G-protein Coupling Assays: Employ BRET/FRET assays to directly measure interactions between opn4b and various G-protein subtypes.

  • Cell-Type Specific Analysis:

    • Single-Cell Transcriptomics: Conduct scRNA-seq on opn4b-expressing cells to identify cell-specific signaling components that may explain divergent results .

    • Cell-Type Isolation: Use FACS or laser-capture microdissection to isolate specific opn4b-expressing cell populations for biochemical analysis.

  • Genetic Manipulation Approaches:

    • CRISPR/Cas9 Gene Editing: Generate targeted mutations in specific signaling components in Xenopus.

    • Pathway-Specific Dominant Negatives: Express dominant-negative constructs targeting specific branches of potential signaling pathways.

  • Advanced Imaging Techniques:

    • Optogenetic Reporters: Develop and employ optogenetic reporters for simultaneous light stimulation and pathway monitoring.

    • Super-Resolution Microscopy: Examine subcellular localization of signaling components to identify spatial compartmentalization.

  • Quantitative Methodology:

Experimental ApproachPrimary MeasurementAdvantagesLimitations
Genetic Knockdown/KnockoutFunctional lossDirect causalityPotential compensation
Pharmacological InhibitionPathway blockadeTemporal controlOff-target effects
Biosensor ImagingReal-time signalingSpatial resolutionPotential artifacts
ElectrophysiologyFunctional activityDirect readoutLimited throughput
Biochemical AssaysProtein interactionsMolecular specificityCellular disruption

By integrating these approaches, researchers can resolve contradictions and develop a comprehensive model of opn4b signaling that accounts for cell-type specificity, developmental context, and potential multiple parallel pathways.

How might CRISPR-Cas9 gene editing be applied to study opn4b function in Xenopus laevis?

CRISPR-Cas9 gene editing offers powerful approaches to investigate opn4b function in Xenopus laevis:

  • Knockout Strategies:

    • Complete Gene Knockout: Design sgRNAs targeting early exons of opn4b to create frameshift mutations.

    • Domain-Specific Editing: Create precise mutations in functional domains (chromophore binding pocket, G-protein interaction sites) to dissect structure-function relationships.

    • Allele-Specific Targeting: Due to the allotetraploid nature of Xenopus laevis (which has 22 distinct type-II opsin genes) , design homeolog-specific sgRNAs to target individual opn4b copies.

  • Knockin Approaches:

    • Reporter Integration: Insert fluorescent reporters (GFP, mCherry) in-frame with opn4b to track expression patterns during development and metamorphosis.

    • Optogenetic Tag Integration: Introduce optogenetic actuators to manipulate specific signaling pathways in opn4b-expressing cells.

    • Epitope Tagging: Insert small epitope tags for improved antibody detection and protein interaction studies.

  • Methodological Considerations:

    • Delivery Methods: Inject Cas9 protein and sgRNAs directly into fertilized eggs for germline transmission.

    • Efficiency Verification: Use T7 endonuclease assays or direct sequencing to confirm editing efficiency.

    • Mosaicism Management: Create F0 founders followed by breeding to establish stable lines.

  • Phenotypic Analysis:

    • Behavioral Assays: Assess alterations in light-dependent behaviors and circadian rhythms.

    • Electrophysiological Measurements: Record from retinal cells to detect changes in light responsiveness.

    • Developmental Tracking: Monitor metamorphosis progression and retinal development.

  • Combinatorial Approaches:

    • Multiplex Editing: Target multiple melanopsin genes simultaneously to address functional redundancy.

    • Conditional Systems: Combine with inducible systems for temporal control of gene disruption.

This genome editing approach would significantly advance understanding of opn4b's specific contributions to photoreception in Xenopus, distinct from other melanopsin variants.

What potential therapeutic applications might arise from studying opn4b signaling in Xenopus laevis?

Research on Xenopus laevis opn4b signaling could inform several therapeutic applications:

  • Circadian Rhythm Disorders:

    • Understanding melanopsin signaling pathways could lead to targeted therapies for disorders like delayed sleep phase syndrome.

    • Compounds that modulate specific components of the melanopsin pathway might be developed as chronotherapeutics.

  • Retinal Degeneration Treatments:

    • As melanopsin-expressing cells often survive in retinal degenerations that destroy rods and cones, opn4b research could inform optogenetic approaches to restore photosensitivity.

    • The unique signal transduction mechanisms of melanopsin could inspire novel therapeutic targets distinct from classical visual restoration approaches.

  • Non-Visual Light Effects:

    • Research on opn4b could improve understanding of how light affects mood, learning, and alertness.

    • This knowledge could inform light-based therapies for seasonal affective disorder, jetlag, and cognitive enhancement.

  • Developmental Therapeutics:

    • Insights from opn4b's role during Xenopus metamorphosis may translate to understanding human developmental disorders involving sensory-motor integration.

    • The complex retinal remodeling during Xenopus development could inform regenerative approaches for human retinal injury.

  • Drug Discovery Platform:

    • The Xenopus oocyte system, widely used for expressing human membrane proteins , could be adapted as a screening platform for compounds targeting human melanopsin.

    • The detailed understanding of opn4b signaling could identify novel druggable targets in the melanopsin pathway.

By elucidating the fundamental biology of opn4b in Xenopus, researchers can establish translational bridges to human health applications, particularly in disorders involving non-visual photoreception, circadian rhythms, and retinal function.

What are common pitfalls in expressing functional recombinant opn4b and how can they be overcome?

Researchers commonly encounter several challenges when expressing functional recombinant opn4b. Here are the major pitfalls and their solutions:

  • Protein Misfolding and Aggregation:

    • Problem: Membrane proteins like opsins often misfold when overexpressed.

    • Solutions:

      • Lower expression temperature (28-30°C instead of 37°C)

      • Use specialized expression vectors with chaperone co-expression

      • Add chemical chaperones like glycerol or DMSO to culture media

      • Consider fusion tags that enhance solubility (SUMO, MBP)

  • Inefficient Chromophore Incorporation:

    • Problem: Recombinant opsins may fail to incorporate 11-cis-retinal efficiently.

    • Solutions:

      • Supplement expression media with all-trans-retinal (which can isomerize to 11-cis in some systems)

      • Perform reconstitution with chromophore in detergent micelles prior to functional assays

      • Optimize chromophore:protein ratios and incubation conditions

  • Subcellular Localization Issues:

    • Problem: Retention in ER/Golgi instead of plasma membrane localization.

    • Solutions:

      • Include trafficking enhancement signals in construct design

      • Use cell lines with proven success for opsin expression (HEK293, COS-7)

      • Optimize codon usage for the expression system

  • Functional Assessment Difficulties:

    • Problem: Challenges in demonstrating light responsiveness.

    • Solutions:

      • Use multiple complementary functional assays (electrophysiology, calcium imaging, cGMP assays)

      • Ensure appropriate light stimulation (450-470 nm wavelengths at sufficient intensity)

      • Include positive controls (well-characterized opsins) in parallel experiments

  • Technical Troubleshooting Guide:

IssueDiagnostic IndicatorPotential Solution
Low expression levelsWeak band on Western blotOptimize codon usage, enhance promoter strength
Chromophore associationAbnormal absorption spectrumIncrease chromophore concentration, extend incubation time
AggregationHigh molecular weight bands on non-reducing gelsAdd solubilizing agents, reduce expression temperature
Non-functionalityNo light-induced responseVerify protein integrity, confirm proper folding
DegradationMultiple bands on Western blotAdd protease inhibitors, reduce expression time

By anticipating and addressing these common challenges, researchers can significantly improve the likelihood of obtaining functional recombinant opn4b for subsequent studies.

How can researchers effectively analyze potential interactions between opn4b and other photoreceptive proteins in the Xenopus retina?

To effectively analyze interactions between opn4b and other photoreceptive proteins in the Xenopus retina, researchers should employ a multi-layered experimental approach:

  • Co-expression Analysis:

    • Double Fluorescent In Situ Hybridization (FISH): Similar to studies showing 24% overlap between opn5 and opn4a , use double FISH to quantify co-expression of opn4b with other opsins.

    • Single-cell RNA Sequencing: Apply scRNA-seq to identify cells co-expressing opn4b and other photoreceptive proteins.

    • Immunohistochemistry: Use antibodies against opn4b and other opsins to assess protein co-localization at subcellular resolution.

  • Protein-Protein Interaction Studies:

    • Co-immunoprecipitation: Pull down opn4b and identify interacting proteins by mass spectrometry.

    • Proximity Labeling: Use BioID or APEX2 fused to opn4b to identify proteins in close proximity in living cells.

    • FRET/BRET Analysis: Develop fluorescent/bioluminescent fusion constructs to detect direct interactions in live cells.

  • Functional Interaction Studies:

    • Electrophysiological Cross-talk: Record from cells expressing multiple opsins to detect synergistic or antagonistic effects on light responses.

    • Calcium Imaging: Monitor Ca2+ responses in cells expressing combinations of opsins across different wavelengths.

    • Phosphorylation Analysis: Examine whether activation of one opsin affects the phosphorylation state of others.

  • Genetic Interaction Approaches:

    • CRISPR-mediated Knockouts: Create single and combinatorial opsin knockouts to identify genetic interactions.

    • Rescue Experiments: Test whether opn4b can functionally substitute for other opsins when expressed in appropriate cells.

  • Developmental Co-regulation:

    • Temporal Expression Analysis: Track relative expression timing of opn4b and other opsins during development.

    • Circuit Integration: Examine how opn4b-expressing cells integrate into circuits with other photoreceptive cells.

    • Light-dependent Co-regulation: Assess whether light exposure affects expression of multiple opsins coordinately.

By combining these approaches, researchers can build a comprehensive understanding of how opn4b functions within the complex network of photoreceptive proteins in the Xenopus retina, potentially revealing novel signaling interactions and functional specializations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.