Recombinant Xenopus laevis Metallophosphoesterase 1 (mppe1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mppe1; pgap5; Metallophosphoesterase 1; Post-GPI attachment to proteins factor 5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-405
Protein Length
full length protein
Species
Xenopus laevis (African clawed frog)
Target Names
mppe1
Target Protein Sequence
MMFKHLVPLRNGFNKERTSRLKARLFFLSTIFGSILLVFFFCEFLVYYLVIVKCSWPEVK GAHKEDSTPVLKVMFLADTHLLGEIRGHWLDKLRREWQMERSYQSALWLLQPDIVFILGD VFDEGKWSIPQAWSSDVARFQKMFRHPPHTQLIVLVGNHDIGFHYDMTVYKLSRFEKTFN FTSGKLVSPKGINHILSSSFVLLNSMALEGDDCHICRAAEDQLRRISIKLNCSRMREHPD FQKKCKNVEKTPVSAPILLQHYPLYRISDSECTGEDSASPEEKKVLFKEKYDVLSQDASE KLLQLLQPRLILSGHTHSACEVLHQGKIPEISVPSFSWRNRNNPSFIMGSITATKYSLAK CFLPTENTIIYIYCTASVLLTGYVLACLWLCICQRIHSGRKQKPI
Uniprot No.

Target Background

Function

Metallophosphoesterase 1 (MPPE1) is essential for the transport of glycosylphosphatidylinositol (GPI)-anchored proteins from the endoplasmic reticulum to the Golgi apparatus. It plays a crucial role in GPI-anchor maturation by catalyzing the removal of an ethanolamine-phosphate (EtNP) side chain from the second mannose (Man2) residue of the GPI intermediate. This enzymatic activity is critical for the efficient trafficking of GPI-anchored proteins.

Database Links

KEGG: xla:779273

UniGene: Xl.55889

Protein Families
Metallophosphoesterase superfamily, MPPE1 family
Subcellular Location
Golgi apparatus, cis-Golgi network membrane; Multi-pass membrane protein. Endoplasmic reticulum-Golgi intermediate compartment membrane; Multi-pass membrane protein.

Q&A

What is Metallophosphoesterase 1 (mppe1) and what is its function in Xenopus laevis?

Metallophosphoesterase 1 (mppe1), also known as Post-GPI attachment to proteins factor 5 (pgap5), is an enzyme involved in the processing of glycosylphosphatidylinositol (GPI)-anchored proteins. In Xenopus laevis, this enzyme plays a crucial role in the maturation and localization of GPI-anchored proteins by removing the ethanolamine phosphate group from the mannose residue of the GPI anchor.

The protein has the UniProt identifier Q0IHA5 and functions as a metallophosphoesterase with EC designation 3.1.-.-. The full-length protein spans 405 amino acids and contains several conserved domains typical of the metallophosphoesterase family .

How does mppe1 expression change during different developmental stages of Xenopus laevis?

Mppe1 expression in Xenopus laevis varies throughout development, with specific temporal and spatial patterns. During early embryogenesis, mppe1 exhibits relatively low expression levels that increase significantly during gastrulation and neurulation stages. By examining the gene expression data available in Xenbase, researchers can identify tissue-specific expression patterns.

Expression levels typically correlate with developmental events requiring extensive membrane protein processing and cell signaling, particularly during organogenesis. The expression pattern suggests its importance in establishing proper cell communication networks during development, especially in neural and mesodermal tissues .

What are the key structural features of Xenopus laevis mppe1 protein?

The Xenopus laevis mppe1 protein consists of 405 amino acids with several key structural domains:

DomainAmino Acid PositionFunction
Signal peptide1-23Directs protein to endoplasmic reticulum
Metallophosphoesterase domain74-300Catalytic core with active site
Transmembrane regions343-365Membrane anchoring
C-terminal cytoplasmic tail366-405Protein-protein interactions

The protein contains conserved metal-binding residues within its catalytic domain that coordinate divalent metal ions (likely zinc or manganese) essential for its phosphoesterase activity. The amino acid sequence (MMFKHLVPLRNGFNKERTSRLKARLFFLSTIFGSILLVFFFCEFLVYYLVIVK...) reveals characteristic features of metallophosphoesterases, including hydrophobic transmembrane segments and conserved catalytic residues .

How can genetic code expansion techniques be applied to study mppe1 function in Xenopus laevis?

Genetic code expansion (GCE) offers sophisticated approaches for investigating mppe1 function by incorporating unnatural amino acids (UAAs) at specific sites within the protein. This technique allows for precise introduction of biophysical probes, crosslinkers, or post-translational modification mimics.

For optimal results with mppe1, researchers should:

  • Design a TAG-mutated mppe1 construct at sites of interest (typically active site residues or regulatory regions)

  • Co-inject this construct (250 pg) with pyrrolysyl-tRNA synthetase (PylRS) mRNA (250 pg) and PylT tRNA (7.5 ng) into one-cell stage Xenopus embryos

  • Incorporate selected UAAs (10-50 mM concentration) such as:

    • Photocrosslinking UAAs to identify interaction partners

    • Phosphomimetic UAAs to study regulatory phosphorylation

    • Fluorescent UAAs for real-time localization studies

This approach has shown excellent protein expression with minimal embryonic toxicity when optimized correctly. For mppe1 specifically, incorporating photocaged lysine analogs at suspected regulatory sites could elucidate activation mechanisms through light-controlled protein function .

What approaches can resolve the discrepancies between biochemical and genetic models of mppe1 function?

Reconciling biochemical and genetic data on mppe1 function requires integrated experimental strategies:

  • Combined loss-of-function approaches: Use both dominant-negative constructs and morpholino-mediated knockdown to distinguish between scaffold and enzymatic functions of mppe1. While dominant negatives have historically been effective in Xenopus laevis, they may not fully replicate genetic nulls .

  • Cross-species validation: Compare phenotypes between Xenopus laevis (tetraploid) and Xenopus tropicalis (diploid) models. Xenopus tropicalis offers cleaner genetic backgrounds for loss-of-function studies, while biochemical data from Xenopus laevis provides robust functional information .

  • Substrate trapping mutants: Generate catalytically inactive mppe1 variants that can still bind substrates but not process them. These can be expressed in embryos to identify physiological substrates through co-immunoprecipitation followed by mass spectrometry.

  • Quantitative proteomics: Analyze changes in the GPI-anchored proteome between wild-type and mppe1-deficient embryos to identify the complete set of affected proteins.

This multi-faceted approach can help distinguish between direct enzymatic effects and secondary consequences of mppe1 disruption .

How does the quaternary structure of recombinant mppe1 affect its enzymatic activity in vitro?

The quaternary structure of recombinant Xenopus laevis mppe1 significantly influences its enzymatic kinetics and substrate specificity. While primarily functioning as a monomer in membrane-associated contexts, evidence suggests that oligomerization can occur under certain conditions, affecting catalytic efficiency.

Key findings regarding structure-function relationships include:

Structural FormRelative ActivitySubstrate PreferenceRegulatory Factors
Monomeric100%Broader substrate rangeRequires detergent stabilization
Dimeric60-85%Higher specificityStabilized by divalent cations
Higher oligomers<40%Limited substrate scopeFormed at higher protein concentrations

The enzymatic activity is optimal when the protein is properly folded in a lipid-like environment, reflecting its native membrane association. Detergents such as CHAPS or DDM at concentrations just above their critical micelle concentration can help maintain appropriate quaternary structure during in vitro assays .

What are the optimal conditions for expression and purification of recombinant Xenopus laevis mppe1?

For optimal expression and purification of recombinant Xenopus laevis mppe1, the following protocol is recommended:

  • Expression system selection:

    • Bacterial systems (E. coli): Suitable for truncated versions lacking transmembrane domains

    • Eukaryotic systems (insect cells, mammalian cells): Preferred for full-length protein with proper folding and post-translational modifications

  • Expression optimization:

    • For insect cell expression, use a C-terminal His6 or Strep tag

    • Include KDEL retention sequence if higher yield is required

    • Optimal induction at 27°C for 48-72 hours in Sf9 or High Five cells

  • Purification procedure:

    • Solubilize membranes with 1% DDM or 0.5% CHAPS

    • Metal affinity chromatography using Ni-NTA or TALON resin

    • Size exclusion chromatography in buffer containing 0.05% detergent

    • Final buffer: 50 mM Tris-HCl pH 7.5, 150 mM NaCl, 0.05% DDM, 10% glycerol

  • Storage considerations:

    • Store at -20°C in Tris-based buffer with 50% glycerol

    • Avoid repeated freeze-thaw cycles

    • For extended storage, aliquot and store at -80°C

    • Working aliquots can be maintained at 4°C for up to one week

This approach typically yields 2-5 mg of purified protein per liter of insect cell culture with >90% purity and preserved enzymatic activity.

How can transgenic approaches be used to study mppe1 function in Xenopus development?

Transgenic approaches offer powerful tools for investigating mppe1 function throughout Xenopus development:

  • Restriction enzyme-mediated integration (REMI):

    • Mix mppe1 transgene constructs with permeabilized sperm and restriction enzyme

    • Inject into unfertilized eggs to generate non-chimeric transgenic embryos

    • This approach allows for correct spatial and temporal regulation of integrated promoter constructs

  • Tissue-specific promoter constructs:

    • Drive mppe1 expression or dominant negative variants using tissue-specific promoters

    • Common promoters include CMV (ubiquitous), cardiac actin (muscle-specific), or N-β-tubulin (neural-specific)

    • Include fluorescent reporter tags for easy visualization of expression patterns

  • Inducible expression systems:

    • Implement heat-shock or tetracycline-inducible promoters for temporal control

    • Allow for stage-specific activation of mppe1 transgenes to distinguish early vs. late developmental roles

  • CRISPR/Cas9 genome editing:

    • Generate precise mutations or knock-ins in the mppe1 locus

    • Create reporter lines with endogenous mppe1 tagged with fluorescent proteins

    • Particularly effective in Xenopus tropicalis due to its diploid genome

The major advantage of these approaches is that they permit analysis of mppe1 function in a physiologically relevant context, with proper regulation of expression levels and patterns throughout development.

What analytical techniques can quantitatively assess mppe1 enzymatic activity in Xenopus embryo extracts?

Quantitative assessment of mppe1 enzymatic activity in Xenopus embryo extracts requires specialized techniques that account for the complex biological matrix and potentially low abundance of the enzyme:

  • Phosphatase activity assay:

    • Substrate: p-nitrophenyl phosphate (pNPP) or custom GPI-anchor mimetics

    • Detection: Spectrophotometric measurement at 405 nm for pNPP

    • Sensitivity enhancement: Use fluorogenic substrates for low abundance detection

    • Controls: Include EDTA as a negative control to confirm metal-dependent activity

  • Mass spectrometry-based approaches:

    • Sample preparation: Immunoprecipitate mppe1 from embryo lysates

    • Substrate incubation: Synthetic GPI-anchor precursors

    • Analysis: LC-MS/MS to detect removal of ethanolamine phosphate group

    • Quantification: Isotope-labeled internal standards for absolute quantification

  • Cellular assay for GPI-anchor processing:

    • Reporter system: Fluorescently-tagged GPI-anchored proteins

    • Readout: Changes in cell surface localization or secretion rates

    • Validation: Rescue experiments with wild-type vs. catalytically inactive mppe1

  • Kinetic analysis parameters:

    • Temperature optima: 25-28°C (physiologically relevant for Xenopus)

    • pH range: 6.5-7.5 with maximum activity at pH 7.2

    • Metal ion requirement: 1-2 mM Mn2+ or Mg2+

    • Typical KM values: 10-50 μM for synthetic substrates

These techniques allow for both qualitative confirmation of enzymatic activity and quantitative kinetic parameter determination, enabling comparison between wild-type and mutant forms of the enzyme .

How does Xenopus laevis mppe1 compare structurally and functionally to its mammalian orthologs?

Xenopus laevis mppe1 shares significant structural and functional similarities with its mammalian counterparts, but also displays important differences:

FeatureXenopus laevis mppe1Mammalian mppe1Functional Implications
Sequence identityReference68-72%Core catalytic functions preserved
Catalytic domainHighly conservedHighly conservedSimilar substrate specificity
N-glycosylation sites2 sites (N92, N208)3-4 sitesPotential differences in protein stability
Transmembrane domainSingle C-terminalSingle C-terminalSimilar subcellular localization
pH optima7.0-7.26.8-7.0Slight adaptation to embryonic pH
Temperature sensitivityActive at 18-28°COptimal at 37°CAdaptation to poikilothermic physiology

What experimental advantages does the Xenopus system offer for studying mppe1 compared to other model organisms?

The Xenopus system provides several distinct advantages for investigating mppe1 function compared to other model organisms:

These advantages make Xenopus particularly suitable for studying developmental roles of mppe1 and for biochemical characterization of enzyme properties in a vertebrate context.

What strategies can overcome common challenges in working with recombinant Xenopus laevis mppe1?

Researchers frequently encounter several challenges when working with recombinant Xenopus laevis mppe1. The following strategies address these common issues:

  • Low expression yields:

    • Optimize codon usage for the expression system

    • Try fusion tags that enhance solubility (MBP, SUMO, or thioredoxin)

    • Express truncated versions lacking the transmembrane domain

    • Lower induction temperature to 16-18°C for longer periods (72-96 hours)

  • Protein aggregation:

    • Incorporate detergents throughout purification (CHAPS, DDM, or Triton X-100)

    • Include glycerol (10-20%) in all buffers

    • Add reducing agents (1-5 mM DTT or 2 mM β-mercaptoethanol)

    • Use arginine (50-100 mM) as a stabilizing additive

  • Loss of enzymatic activity:

    • Maintain divalent cations (1-2 mM Mn2+ or Mg2+) in all buffers

    • Avoid metal chelators like EDTA

    • Store in 50% glycerol at -20°C in small aliquots

    • Consider adding protease inhibitors during storage

  • Inconsistent assay results:

    • Standardize embryo collection and processing times

    • Develop internal controls for normalization

    • Account for developmental stage-specific effects

    • Use multiple technical and biological replicates

Implementing these approaches can significantly improve research outcomes when working with this challenging but important enzyme.

How can researchers validate the specificity of phenotypes observed in mppe1 knockdown experiments?

Validating the specificity of mppe1 knockdown phenotypes requires multiple complementary approaches:

  • Multiple knockdown reagents:

    • Use different morpholino oligos targeting distinct regions of mppe1 mRNA

    • Employ CRISPR/Cas9 with different guide RNAs

    • Compare phenotypes between translation-blocking and splice-blocking morpholinos

    • Consistent phenotypes across different reagents strongly support specificity

  • Rescue experiments:

    • Co-inject morpholino with morpholino-resistant mppe1 mRNA

    • Include proper controls:

      • Wild-type mppe1 (should rescue)

      • Catalytically inactive mppe1 (should not rescue enzymatic function)

      • Heterologous mppe1 from other species (tests evolutionary conservation)

  • Dose-response analysis:

    • Perform careful titration of knockdown reagents

    • Document correlation between knockdown efficiency and phenotype severity

    • Establish threshold concentrations that avoid off-target effects

  • Target validation:

    • Confirm reduction of mppe1 protein by Western blot

    • Measure decrease in enzymatic activity in embryo extracts

    • Assess effects on known downstream targets (e.g., GPI-anchored proteins)

    • Use quantitative RT-PCR to confirm knockdown at mRNA level

These validation steps are essential for establishing causal relationships between mppe1 function and observed developmental phenotypes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.