Recombinant Xenopus laevis Methyltransferase-like protein 23 (mettl23)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mettl23; Probable methyltransferase-like protein 23
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-234
Protein Length
full length protein
Species
Xenopus laevis (African clawed frog)
Target Names
mettl23
Target Protein Sequence
MGEENEQRIGERVYEFLRREGKDEQKMRVTIPEVLNCQYGMYVWPCAVVLAQYLWYHRKN LADKRVLEVGAGVSLPGILAAKCGAKVILSDSAEMPQCLENCRRSCKMNNIVGVPVIGLT WGEVSPDLLDLPPIDIILGSDVFYEPKDFEDILLTVRFLMERMPQAEFWTTYQVRSADWS VEALLCKWNLKCTNVPLKTFDADNECLAGSELPGRHTVQMMIITLDRKGAGHTG
Uniprot No.

Target Background

Function
Putative methyltransferase.
Database Links

KEGG: xla:444818

UniGene: Xl.18290

Protein Families
Methyltransferase superfamily, METTL23 family
Subcellular Location
Cytoplasm. Membrane; Single-pass membrane protein.

Q&A

What is the predicted structure and function of Xenopus laevis METTL23?

METTL23 in X. laevis, like its human ortholog, is strongly predicted to function as an S-adenosyl-methionine (SAM)-dependent methyltransferase. Structural bioinformatics analyses of METTL23 reveal a characteristic 3D fold typical of methyltransferases, containing a binding site for the methylation cofactor SAM. Approximately 25 residues are predicted to build up the SAM/SAH-binding site, with about 50% of these residues completely conserved among SAM/SAH-binding proteins . The functional catalytic domain is essential for proper methyltransferase activity, and truncation variants lacking portions of the central β-sheet of the protein are predicted to be improperly folded and enzymatically inactive .

How does X. laevis METTL23 compare with its homologs in other species?

X. laevis METTL23 shares significant structural and functional homology with human and other vertebrate METTL23 proteins. The core methyltransferase domain is generally well-conserved across species, particularly in the SAM-binding region. Mutations in human METTL23 have been associated with intellectual disability, suggesting conserved neurological functions across species . Researchers should note that X. laevis, like many genes in this tetraploid species, may have two copies of METTL23 (METTL23.L and METTL23.S) analogous to the dmrt1.L and dmrt1.S paralogs described in the X. laevis genome .

What are effective protocols for recombinant expression of X. laevis METTL23?

For recombinant expression of X. laevis METTL23, bacterial expression systems using E. coli BL21 host cells have been shown to produce good protein yields, though the protein may form inclusion bodies when expressed alone . To improve solubility, co-expression with molecular chaperones (e.g., GroEL) is recommended. Expression constructs should be designed with appropriate affinity tags (e.g., His8-tag) to facilitate purification .

The optimal expression protocol should include:

  • Transformation into competent E. coli BL21 cells

  • Culture growth at 37°C until OD600 reaches 0.6-0.8

  • Induction with IPTG (0.5-1mM) at reduced temperature (16-18°C)

  • Co-expression with chaperones to enhance solubility

  • Overnight expression followed by centrifugation and lysis

How can researchers overcome solubility issues when purifying recombinant METTL23?

Solubility challenges with recombinant METTL23 can be addressed through several approaches:

  • Co-expression with molecular chaperones (e.g., GroEL/GroES) significantly improves solubility, though researchers should note that METTL23 may co-elute with these chaperones during purification .

  • Optimization of buffer conditions during lysis and purification, including the addition of stabilizing agents such as glycerol (10-15%).

  • Expression at lower temperatures (16-18°C) to slow protein synthesis and allow proper folding.

  • Use of solubility-enhancing fusion tags (e.g., MBP, SUMO) in addition to affinity tags.

It's important to note that attempts to release METTL23 from chaperones (e.g., by addition of ATP) may be unsuccessful, indicating tight binding between METTL23 and chaperone proteins . This tight binding aligns with findings suggesting METTL23 associates with the endoplasmic reticulum membrane and potentially interacts with heat shock proteins as substrates .

What methods are effective for analyzing the methyltransferase activity of recombinant X. laevis METTL23?

To analyze the methyltransferase activity of recombinant X. laevis METTL23, researchers can employ several complementary approaches:

  • In vitro methylation assays: Using purified recombinant METTL23 with potential substrate proteins (especially heat shock proteins) and radiolabeled SAM (S-adenosyl-L-[methyl-³H]methionine) to detect transfer of methyl groups.

  • Mass spectrometry analysis: Peptides and their methylation states can be analyzed using extracted ion chromatograms of the monoisotopic peak (±10 ppm) as described for other methyltransferases. For higher accuracy with specific peptides like eEF1A2 AspN peptide, a tolerance of ±5 ppm may be used .

  • Protein-protein interaction studies: Co-immunoprecipitation experiments to identify interaction partners, particularly heat shock proteins and chaperones that may be methylation substrates .

  • Immunoblotting with methylation-specific antibodies: To detect specific methylation events on target proteins in the presence or absence of active METTL23.

How can researchers identify potential substrates for X. laevis METTL23?

Identification of potential substrates for X. laevis METTL23 can be approached through multiple strategies:

  • Affinity purification coupled with mass spectrometry: Expressing tagged METTL23 in X. laevis cells or tissues, followed by pull-down experiments and mass spectrometric identification of interacting proteins.

  • Comparative proteomics: Analyzing differences in protein methylation patterns between wild-type and METTL23 knockout/knockdown samples using quantitative proteomics approaches.

  • Candidate approach: Based on known interactions in human studies, heat shock proteins and chaperones represent high-priority candidates for investigation . The tight binding observed between METTL23 and chaperones like GroEL (homologous to human HSP60) suggests these may be primary substrates .

  • In vitro methylation screening: Systematic testing of recombinant METTL23 against a panel of potential substrate proteins, particularly focusing on translation factors and chaperones.

What are optimal protocols for generating METTL23 knockouts in Xenopus models?

For generating METTL23 knockouts in Xenopus models, CRISPR-Cas9 gene editing has proven effective. Based on successful knockout protocols for related genes in X. laevis and X. tropicalis, researchers should consider the following approach:

  • Guide RNA design: Design guide RNAs targeting the 5' portion of the coding regions of METTL23 to introduce deletions and frameshift mutations. Multiple guide RNAs may be required if targeting both METTL23.L and METTL23.S in X. laevis .

  • Delivery method: Inject CRISPR-Cas9 components (guide RNAs and Cas9 protein or mRNA) into fertilized eggs at the one-cell stage.

  • F0 mosaic screening: Screen F0 mosaic individuals and cross them with wildtypes to generate non-mosaic F1 individuals with germline transmission .

  • F1 genotyping and crossing: Intercross F1 heterozygotes to generate homozygous null and heterozygous F2 individuals .

  • Genotype verification: Extract DNA from samples (e.g., foot webbing) using commercial kits like DNeasy (Qiagen) and perform Sanger sequencing to confirm genotypes .

For allelic variation analysis in knockout clones, TA cloning using systems like pGEM-T Easy can be employed, followed by sequencing of multiple transformants to determine the precise mutations present .

How can researchers verify the functional disruption of METTL23 in knockout models?

Verification of functional disruption in METTL23 knockout models should involve multiple complementary approaches:

  • Protein expression analysis: Use immunoprecipitation and Western blotting with antibodies specific to different regions of METTL23 to confirm the absence of full-length protein or presence of truncated forms .

  • Methylation activity assessment: Analyze the methylation status of putative substrate proteins in knockout versus wildtype samples using mass spectrometry .

  • Phenotypic analysis: Examine developmental outcomes, particularly focusing on neurological development and function, given the association of METTL23 mutations with intellectual disability in humans .

  • Transcriptome analysis: Perform RNA-seq to identify genes differentially expressed between knockout and wildtype animals, which may reveal downstream pathways affected by METTL23 disruption.

  • Subcellular localization studies: Verify altered localization patterns of mutant METTL23 proteins compared to wildtype, as truncation may disrupt normal cellular distribution .

How does METTL23 function relate to developmental processes in X. laevis?

  • Neurological development: Given the association of METTL23 mutations with intellectual disability in humans, researchers should investigate the role of METTL23 in brain development and neuronal function in X. laevis . This could include examining neuronal migration, axon guidance, and synapse formation in wildtype versus knockout animals.

  • Cellular stress responses: The interaction between METTL23 and heat shock proteins suggests a potential role in cellular stress responses during development . Temperature shift experiments during critical developmental windows could reveal stage-specific requirements for METTL23 function.

  • Translational regulation: If METTL23 methylates translation factors in X. laevis as suggested for human METTL21B, it may influence protein synthesis rates during key developmental transitions .

  • Tissue-specific requirements: Analysis of METTL23 expression patterns across tissues and developmental stages would help identify where and when this methyltransferase functions during X. laevis development.

What are the challenges in distinguishing functional redundancy between methyltransferase family members in X. laevis?

Distinguishing functional redundancy between methyltransferase family members in X. laevis presents several challenges:

  • Genome duplication complexity: The pseudotetraploid nature of X. laevis means researchers must address potential redundancy not only between different methyltransferase family members but also between homeologous copies of the same gene (e.g., METTL23.L and METTL23.S) .

  • Substrate overlap: Multiple methyltransferases may target the same proteins but at different residues or under different conditions. For example, both METTL21B and METTL23 have been implicated in methylation of translation factors .

  • Methodological approaches:

    • Generate single and combined knockouts of related methyltransferases

    • Perform detailed mass spectrometry analysis to map specific methylation sites and how they change in different knockout backgrounds

    • Use domain swapping experiments to identify regions conferring substrate specificity

    • Employ temporal and spatial expression analysis to identify differences in when and where related methyltransferases function

  • Compensatory mechanisms: Long-term developmental compensation may mask acute phenotypes, necessitating inducible knockout approaches or acute protein degradation methods to reveal immediate functional consequences.

How does X. laevis METTL23 compare functionally to mammalian METTL23?

X. laevis METTL23 likely shares core functional characteristics with its mammalian counterparts, though with potential species-specific adaptations:

  • Conserved catalytic mechanism: The SAM-dependent methyltransferase domain and catalytic residues are likely highly conserved between X. laevis and mammalian METTL23 proteins .

  • Substrate specificity: While core substrates may be conserved (particularly heat shock proteins), X. laevis METTL23 may have evolved to recognize species-specific protein variants or acquired additional substrates relevant to amphibian physiology .

  • Subcellular localization: Human METTL23 isoform 1 localizes to the endoplasmic reticulum while isoform 2 shows nuclear localization . Researchers should determine whether X. laevis METTL23 shows similar localization patterns and isoform diversity.

  • Developmental timing: Expression patterns during development may differ between mammals and amphibians, reflecting the distinct developmental trajectories of these vertebrate lineages.

  • Interaction networks: The protein-protein interaction landscape may differ, with X. laevis METTL23 potentially engaging with species-specific interaction partners.

Comparative functional studies examining the ability of X. laevis METTL23 to complement human METTL23 deficiency models would be particularly informative for determining the degree of functional conservation.

What methodological considerations are important when extrapolating findings from X. laevis METTL23 studies to human disease models?

When extrapolating findings from X. laevis METTL23 studies to human disease contexts, researchers should consider:

  • Genome duplication effects: The presence of two METTL23 copies in X. laevis (due to its pseudotetraploid genome) may provide functional redundancy not present in humans, potentially masking phenotypes that would be evident in human models .

  • Developmental timing differences: The extended external development of X. laevis embryos versus mammalian development means temporal aspects of METTL23 function may not directly translate between systems.

  • Temperature considerations: As ectotherms, X. laevis develop at lower temperatures than mammals, which may affect methyltransferase kinetics and interactions with heat shock proteins that are temperature-sensitive.

  • Experimental validation across systems: Key findings from X. laevis should be validated in mammalian cell culture or mouse models before clinical extrapolation.

  • Cross-species complementation: Testing whether human METTL23 can rescue X. laevis METTL23 knockout phenotypes (and vice versa) can help establish functional equivalence.

  • Residue-specific conservation: Detailed alignment of methylation target sites between X. laevis and human proteins is essential to ensure the same residues are being modified in both systems.

What techniques can identify interaction partners of METTL23 in X. laevis?

To identify interaction partners of METTL23 in X. laevis, researchers can employ several complementary techniques:

  • Proximity-dependent biotin identification (BioID): Fusing METTL23 to a biotin ligase to biotinylate proteins in close proximity, followed by streptavidin pull-down and mass spectrometry.

  • Co-immunoprecipitation coupled with mass spectrometry: Using antibodies against endogenous or epitope-tagged METTL23 to pull down interaction complexes .

  • Yeast two-hybrid screening: Using X. laevis METTL23 as bait against a cDNA library derived from relevant X. laevis tissues or developmental stages.

  • Cross-linking mass spectrometry: Chemical cross-linking of protein complexes followed by mass spectrometry to capture transient or weak interactions.

  • Fluorescence resonance energy transfer (FRET): To validate specific interactions in live cells and determine their subcellular localization.

Based on findings from human studies, researchers should particularly focus on potential interactions with heat shock proteins and chaperones, which may represent both interaction partners and methylation substrates for METTL23 .

How does the tight binding of METTL23 to chaperones affect experimental design and interpretation?

The tight binding of METTL23 to chaperones presents several important considerations for experimental design and data interpretation:

  • Purification challenges: Standard purification methods may yield METTL23-chaperone complexes rather than isolated METTL23. Attempts to release METTL23 from chaperones (e.g., with ATP) may be unsuccessful , requiring alternative approaches such as:

    • Denaturing and refolding protocols

    • Expressing and purifying METTL23 domains separately

    • Using mutations that disrupt chaperone binding without affecting catalytic activity

  • Functional analysis complexity: It may be difficult to distinguish whether observed effects stem from METTL23's catalytic activity or from its physical interaction with chaperones. Control experiments should include:

    • Catalytically inactive METTL23 mutants that retain chaperone binding

    • Binding-deficient METTL23 mutants that retain catalytic activity

    • Comparison with other methyltransferases that don't bind chaperones

  • Biological significance: The tight binding suggests METTL23-chaperone interaction may have functional importance beyond substrate recognition, potentially serving regulatory or localization functions . Researchers should investigate:

    • Whether binding is regulated by cellular conditions

    • If binding affects chaperone function independently of methylation

    • The stoichiometry and stability of the complex in vivo

  • Evolutionary conservation: Comparing the chaperone-binding properties of METTL23 across species can help determine whether this feature is conserved and functionally important.

This tight association aligns with findings that several human methyltransferases interact with molecular chaperones and regulate their activity through methylation of conserved lysine residues .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.