Recombinant Xenopus laevis Mitochondrial import inner membrane translocase subunit Tim21 (timm21)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Xenopus laevis Mitochondrial import inner membrane translocase subunit Tim21 (timm21) refers to a specific protein involved in the import of proteins into the mitochondria of the African clawed frog, Xenopus laevis. Tim21 is a subunit of the presequence translocase, which is located in the inner mitochondrial membrane . It plays a crucial role in the translocation of proteins synthesized in the cytoplasm into the mitochondrial matrix . Recombinant Tim21 is produced using genetic engineering techniques, where the gene encoding Tim21 from Xenopus laevis is inserted into a host organism (e.g., E. coli) to produce the protein in large quantities for research purposes .

Production of Recombinant Tim21

Recombinant Tim21 is produced using E. coli as the expression host . The Xenopus laevis gene encoding transmembrane protein 214-B (Tmem214-B), also known as Tim21, is used . The recombinant protein is full-length, comprising 679 amino acids, and includes an N-terminal His tag for purification .

Table 1: Recombinant Tim21 Production Details

FeatureDescription
SpeciesXenopus laevis
SourceE. coli
TagHis tag
Protein LengthFull Length (1-679 amino acids)
FormLyophilized powder
Amino Acid SequenceMASGAPDGKWKVVKKGKKSGERREGERKALTESNVTPGGTAPIKMANTVYEMGFDRIHKKQNKEQVPPNNMSSEQPQKQQQNPGKKKPQSGDSVCKQSKFHTLECALKALDVAELQRDLEKSQNMFPENPSIWVKDLAGYLNYKLQTVKNDVLIQQSHDYPYCLINKELKGIVRSLLAKAPHVLDVMVDHCIFSMLQELDKPTGESLHGYRICIQAVLLDKPKTVTSNLPKYLELLRSHLNRPMKCLTVMWAVGQAGFTDFTEGLKVWLGLMFPVLGVKNLTPYAILYLDRLLLAHSNLTKGFGMIGPKDFFPILDFAFMPNNSLTPSQQENLRNLYPKLKVLALGATPESTLHTYFPSFLSRATPSCPAEMRKELIHSLTDCLNKDSLSFSVWRQLYTKHLSQSSLLLQHLVETWDSNSRAMRKSVRETVHSFKVTNGEFSGKGSSSKDLEACDAACQALLHKMKSGGFPWWRLIVIAFVFLFGSVLYDVRTHNSFQESTSAQILQQSGLLSVSREAWNKVSNYSLQGQSWLERNVPQYSQAVEVLGPVLEQVWAKTQEGGAYACEKGSVLLSYAKDNLPRLIEWLHSSIPDSVFQFIEYLRELLLHLHQTYLLPAVTYLEAAVQNSWQQYVKSCNGKVTWDCVRGQVGNISHSSWTYLQNTTMTFTNWALTIISRH
PurityGreater than 90% as determined by SDS-PAGE
StorageStore at -20°C/-80°C upon receipt, aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles .
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0

Interactions with Other Proteins

Tim21 interacts with several other proteins in the mitochondria:

  • Tom22: Tim21 directly binds to the intermembrane space domain of Tom22, which is crucial for the association between the TOM and TIM23 complexes . Negatively charged amino-acid residues of Tom22 are important for this binding .

  • TIM17:23 complex: Tim21 is a subunit of the TIM17:23 translocase, facilitating the import of proteins into the inner mitochondrial membrane .

  • Respiratory chain complexes: Studies in Arabidopsis thaliana suggest that Tim21-like proteins can interact with respiratory chain Complex I and III, indicating a role in the biogenesis of respiratory chain components .

Role in Protein Import and Mitochondrial Function

Tim21 plays a pivotal role in the import of nuclear-encoded proteins into mitochondria . It is essential for the efficient import and assembly of respiratory chain components and for generating a proton motive force necessary for protein translocation . The dynamic interactions of Tim21 ensure that proteins are correctly sorted and inserted into the inner membrane .

Significance of Xenopus laevis as a Model System

Xenopus laevis is a valuable model organism for studying protein function and cellular processes . Its large oocytes are suitable for expressing and purifying recombinant proteins, making it possible to study protein structures and interactions . The use of Xenopus laevis oocytes allows for the expression of mammalian membrane proteins, facilitating structural analyses that would otherwise be challenging .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
timm21; tim21; Mitochondrial import inner membrane translocase subunit Tim21; TIM21-like protein, mitochondrial
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
32-232
Protein Length
Full Length of Mature Protein
Species
Xenopus laevis (African clawed frog)
Target Names
timm21
Target Protein Sequence
SCLALLHKGAFAAPTSRSLFCAERPISTGCTSLQVKDKRVSVQSTSDGAPPQNASHKVKE AGRDFTYFIVVLIGIGVTGGLFYVVFEELFSSSSPSKIYGEALEKCRSHPEVIGAFGEPI KGYGETTRRGRRQHVSHMEFVKDGIKCMRLKFYIEGSEPRKQGTVHIEVKENPASGKYEF QYIFVEIDTYPRRTIIIEDNR
Uniprot No.

Target Background

Function
May participate in the translocation of transit peptide-containing proteins across the mitochondrial inner membrane.
Database Links

KEGG: xla:494838

UniGene: Xl.9300

Protein Families
TIM21 family
Subcellular Location
Mitochondrion membrane; Single-pass membrane protein.

Q&A

What is the molecular function of Tim21 in mitochondrial protein import?

Tim21 participates in the translocation of transit peptide-containing proteins across the mitochondrial inner membrane. It functions as a connector between the presequence translocase (TIM23 complex) and the TOM complex at the outer membrane. Specifically, Tim21 interacts with the intermembrane space (IMS) domain of Tom22 through electrostatic interactions, with the positively charged surface of Tim21 binding to the negatively charged IMS domain of Tom22 . This connection facilitates the efficient transfer of preproteins from the outer to the inner membrane translocase, ensuring proper mitochondrial protein import.

How does Xenopus laevis Tim21 compare with human TIMM21?

While both proteins serve similar functions in mitochondrial protein import, there are several structural and functional differences:

FeatureXenopus laevis Tim21Human TIMM21
UniProt IDQ5XKA2Q9BVV7
Chromosome-18
Associated diseasesNot well characterizedOptic Atrophy 12, Combined Oxidative Phosphorylation Deficiency 29
Additional functionsPrimary focus on protein importAlso involved in respiratory chain complex assembly (I and IV) as part of MITRAC complex
Length of mature protein201 amino acids (32-232)Varies by isoform

The human TIMM21 has been more extensively characterized in terms of disease associations and has demonstrated additional functions in the assembly of respiratory chain complexes .

How does Tim21 shuttle between the presequence translocase and respiratory chain assembly intermediates?

Tim21 has been identified as a component that not only participates in protein translocation but also functions in the assembly of respiratory chain complexes. Research suggests that Tim21 shuttles between the presequence translocase and respiratory chain assembly intermediates through a dynamic association-dissociation mechanism .

This process appears to involve:

  • Initial binding of Tim21 to the TIM23 complex during preprotein import

  • Subsequent dissociation from TIM23 and association with respiratory chain assembly intermediates

  • Incorporation of newly imported nuclear-encoded subunits into respiratory complexes

The mechanism likely depends on post-translational modifications or conformational changes in Tim21 that modulate its binding affinities. This shuttling activity makes Tim21 a key coordinator between protein import and respiratory chain assembly, ensuring efficient integration of newly imported proteins into functional respiratory complexes .

What experimental approaches can be used to study the interaction between Tim21 and Tom22?

Several experimental approaches have proven effective for investigating Tim21-Tom22 interactions:

  • GST pull-down assays: Using recombinant GST-tagged Tim21 IMS domain to pull down the IMS domain of Tom22 from mitochondrial extracts

  • Site-directed mutagenesis: Systematic replacement of charged residues in Tom22 peptides with alanines to analyze their effect on Tim21 binding, which has revealed that electrostatic interactions play a crucial role

  • Crystallography: X-ray crystallography has been used to solve the structure of Tim21 IMS domain at 1.6 Å resolution, providing insights into the binding interface

  • Competition assays: Using positively charged presequences to compete with Tim21 for binding to Tom22, confirming the electrostatic nature of the interaction

  • Crosslinking experiments: Chemical crosslinking followed by mass spectrometry to identify specific residues involved in the interaction between Tim21 and Tom22

These approaches have collectively demonstrated that a 17-residue segment of Tom22 IMS is sufficient for binding to Tim21 IMS, with two negatively charged residues in this core segment being particularly important for the association .

How can researchers distinguish between the roles of Tim21 in protein import versus respiratory chain assembly?

Distinguishing between these dual functions requires carefully designed experiments:

  • Temporal separation studies: Using pulse-chase experiments with radiolabeled precursor proteins to track the association of Tim21 with different complexes over time

  • Domain-specific mutations: Creating mutants that selectively disrupt either the protein import function or the respiratory chain assembly function

  • Proteomics approaches: Performing BioID or proximity labeling experiments with Tim21 as bait to identify its interaction partners in different functional contexts

  • In vitro reconstitution: Reconstituting the protein import and respiratory chain assembly processes in vitro with purified components to dissect the specific contributions of Tim21

  • Conditional knockout/knockdown systems: Using inducible systems to deplete Tim21 and observe the immediate versus delayed effects on protein import and respiratory chain assembly

These approaches help delineate the specific roles of Tim21 in each process and identify the molecular determinants that regulate its functional switching between these two important activities .

What are the optimal conditions for reconstitution and storage of recombinant Xenopus laevis Tim21?

Based on experimental data, the following protocol is recommended:

  • Reconstitution:

    • Briefly centrifuge the vial containing lyophilized Tim21 protein before opening

    • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Add glycerol to a final concentration of 5-50% (optimally 50%) for long-term storage

    • Aliquot to minimize freeze-thaw cycles

  • Storage conditions:

    • Store working aliquots at 4°C for up to one week

    • For long-term storage, keep at -20°C/-80°C

    • Avoid repeated freeze-thaw cycles as they significantly reduce protein activity

  • Buffer considerations:

    • The protein is typically supplied in a Tris/PBS-based buffer with 6% Trehalose, pH 8.0

    • For functional assays, maintaining pH between 7.5-8.0 is critical for preserving the native conformation and electrostatic properties essential for Tim21-Tom22 interactions

What experimental controls should be included when studying Tim21 interactions with the TOM complex?

When investigating Tim21 interactions with the TOM complex, several controls are essential:

  • Negative controls:

    • GST-only pull-down to control for non-specific binding

    • Unrelated mitochondrial IMS proteins to verify specificity of Tim21-Tom22 interaction

    • Heat-denatured Tim21 to confirm that native protein conformation is required

  • Positive controls:

    • Known interaction partners of Tim21 (e.g., Tim23 components)

    • Established peptide sequences that bind to Tim21

  • Specificity controls:

    • Competition with excess unlabeled Tim21 to demonstrate specific binding

    • Peptide competition assays using Tom22 IMS peptides

    • Salt gradient experiments to verify the electrostatic nature of interactions

  • Structural integrity controls:

    • Circular dichroism to confirm proper folding of recombinant proteins

    • Limited proteolysis to verify domain stability

    • Size exclusion chromatography to confirm monomeric state where appropriate

How can researchers effectively use Tim21 peptides for dissecting the molecular mechanisms of protein import?

Peptide-based approaches offer powerful tools for mechanistic studies:

  • Synthetic peptide design:

    • Design peptides based on the conserved regions of Tim21 IMS domain

    • Include known binding sites for Tom22 interaction

    • Consider both wild-type sequences and variants with strategic amino acid substitutions

  • Competition assays:

    • Use synthetic Tim21-derived peptides to compete with full-length Tim21 for binding to the TOM complex

    • Demonstrate that a peptide representing a core Tim21 sequence impairs the interaction of Tim21 IMS with the TOM complex in solubilized mitochondria

  • Structure-activity relationships:

    • Create a panel of systematically modified peptides (alanine scanning) to identify critical residues

    • Test modified peptides in binding assays to map the interaction surface

  • Crosslinking strategies:

    • Incorporate photo-activatable amino acids into peptides for in situ crosslinking

    • Identify binding partners through mass spectrometry analysis of crosslinked products

  • Fluorescently labeled peptides:

    • Monitor binding kinetics and localization using fluorescence techniques

    • Measure affinities using fluorescence polarization or other quantitative methods

How should researchers interpret conflicting data regarding Tim21's role across different species?

When faced with apparently conflicting data about Tim21 function across species:

What criteria should be used to evaluate the quality of recombinant Xenopus laevis Tim21 for functional studies?

Several quality control parameters should be assessed:

  • Purity assessment:

    • SDS-PAGE analysis should demonstrate >90% purity

    • Mass spectrometry confirmation of protein identity and integrity

  • Structural integrity:

    • Circular dichroism to verify secondary structure content

    • Thermal stability assays to ensure proper folding

  • Functional activity:

    • Binding assays with known interaction partners (e.g., Tom22 IMS domain)

    • Comparison with native protein extracted from Xenopus mitochondria where possible

  • Post-translational modifications:

    • Analysis of phosphorylation or other modifications that might affect function

    • Comparison of E. coli-expressed protein with eukaryotic expression systems

  • Batch-to-batch consistency:

    • Standardized quality control metrics to ensure reproducibility

    • Activity assays to verify consistent functional properties across batches

How can researchers integrate Tim21 functional data into broader models of mitochondrial biogenesis?

Integrating Tim21 data into comprehensive models requires:

  • Multi-omics data integration:

    • Combine proteomics, transcriptomics, and metabolomics data to understand Tim21's role in broader mitochondrial processes

    • Use network analysis to identify functional connections between Tim21 and other mitochondrial systems

  • Temporal dynamics consideration:

    • Analyze Tim21's function in the context of the temporal sequence of mitochondrial biogenesis events

    • Consider how Tim21's dual roles in import and assembly are coordinated over time

  • Stress response integration:

    • Evaluate how Tim21 function changes under different cellular stresses

    • Analyze how these changes contribute to mitochondrial adaptation

  • Structural biology insights:

    • Use structural data on Tim21-Tom22 interactions to inform molecular dynamics simulations

    • Develop mechanistic models of how protein translocation is physically coupled between outer and inner membranes

  • Evolutionary perspective:

    • Compare Tim21 function across species to identify conserved mechanisms

    • Consider how Tim21's role may have evolved alongside changes in mitochondrial complexity

    • Note the novel Tim21-like proteins in plants as potential functional analogs

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.