Recombinant Xenopus laevis Mitochondrial import inner membrane translocase subunit Tim23 (timm23)

What is the structural composition of the Xenopus laevis Tim23 protein?

Xenopus laevis Tim23 protein (Uniprot NO: Q6INU6) consists of 209 amino acid residues. The protein sequence includes multiple transmembrane domains that form the channel component of the mitochondrial inner membrane translocase. The amino acid sequence is: "MDTNHPGSAGGRGGLGSIFGGGPPGYSHSDLAGVPLTGMSPLSPYLNVDPMYLVQDTDEFILPTGANKTRGRFELAFFTIGGCCISGAAFGALNGLKLGFKETQNMPWSKPKNVQILNMVTRQGALWANTLGSLASLYSAFGVIVEKTRGAEDDLNTIAAQTMTGMLYKSTGGLRGVARGGLAQLATASTFALYNNWEHIKGSSSQVSL" . As a membrane protein, Tim23 contains hydrophobic regions that anchor it within the mitochondrial inner membrane, forming a critical part of the protein import machinery.

How does Tim23 function within the TIM23 complex?

Tim23 serves as the core channel-forming component of the TIM23 complex, which facilitates the transport of precursor proteins with cleavable pre-sequences across the mitochondrial inner membrane. Tim23 forms the main channel constituent while interacting with other core components (Tim17 and Tim50) to create the functional translocase . The complex exists in different states depending on its associated proteins: when associated with Tim21 and Mgr2, it forms the TIM23SORT complex for lateral release of proteins with hydrophobic sorting sequences into the membrane; when associated with the pre-sequence translocase-associated motor (PAM), it forms the TIM23MOTOR complex responsible for matrix import . Tim23's transmembrane domains form a pore through which unfolded precursor proteins pass, while its receptor domain recognizes incoming precursors.

What drives protein transport through the Tim23 channel?

Protein transport through Tim23 is energetically driven by two main forces:

• Membrane potential (Δψ) - The electrical component of the proton-motive force across the inner mitochondrial membrane provides an electrophoretic force on the positively charged pre-sequences of import substrates .

• ATP hydrolysis - For complete import into the matrix, the TIM23MOTOR complex utilizes ATP hydrolysis by mtHsp70 (the main component of PAM) to pull precursor proteins through to the matrix after the mitochondrial targeting sequence has been imported .

The relative contribution of these driving forces varies depending on the properties of the precursor protein, particularly its size and net charge. Recent research using split NanoLuc luciferase assays has revealed that these forces act at different steps during the import process, with membrane potential being particularly important for the initial stages of import .

What are the optimal storage and handling conditions for recombinant Xenopus laevis Tim23?

Recombinant Xenopus laevis Tim23 protein should be stored in Tris-based buffer with 50% glycerol at -20°C for routine storage, or at -80°C for extended storage . When working with the protein, it's recommended to:

• Avoid repeated freeze-thaw cycles, as this can lead to protein degradation

• Prepare working aliquots that can be stored at 4°C for up to one week

• Keep the protein in the optimized buffer provided, which is specifically formulated to maintain Tim23's stability and functionality

For experimental applications, it's important to consider that as a membrane protein, Tim23 requires appropriate conditions to maintain its native conformation, which may include detergents or lipid environments depending on the specific application.

How can researchers effectively incorporate Tim23 into model membrane systems for functional studies?

For functional studies of Tim23 channel activity, researchers can incorporate the purified protein into model membrane systems using the following methodology:

• Purify Tim23 to homogeneity from inclusion bodies when expressed in heterologous systems like E. coli

• Prepare large unilamellar vesicles (LUVs) with a lipid composition mimicking the mitochondrial inner membrane

• Incorporate Tim23 into preformed LUVs using established protocols for membrane protein reconstitution

• Verify successful incorporation through techniques such as proteoliposome flotation assays or freeze-fracture electron microscopy

• Conduct functional analyses using electrophysiological techniques such as planar lipid bilayer recordings to measure channel properties

This approach has been successfully used to characterize the electrophysiological properties of Tim23, including ion conductance, voltage gating, and cation selectivity, which are crucial for understanding its role in protein import .

What assays can be used to study Tim23-mediated protein import kinetics?

Recent methodological advances have improved our ability to study the kinetics of Tim23-mediated protein import:

The split NanoLuc luciferase assay has revealed that protein import via the TIM23 complex involves two major rate-limiting steps: passage across the outer membrane and initiation of inner membrane transport, with rates influenced by precursor size and net charge . This contradicts previous models by suggesting that transport through TOM and TIM does not occur in a single continuous step.

How do mutations in Tim23 affect mitochondrial protein import?

Mutational analysis of Tim23 has revealed several critical regions that affect its function:

• Second transmembrane helix mutations: Substitutions of amino acids in the pore-lining second transmembrane helix significantly impact channel function. Specifically, mutations of highly conserved residues (N150A, L155A, A156L, Y159A) exhibit growth defects in yeast models, particularly on non-fermentable carbon sources at elevated temperatures .

• G153L mutation: This mutation produces a lethal phenotype, highlighting its essential role in Tim23 function .

• Cation selectivity mutations: Several Tim23 mutants that showed growth defects (N150A, A156L, Y159A) also exhibited significantly reduced reversal potential in electrophysiological experiments, indicating that the cation selectivity of the Tim23 channel is crucial for substrate recognition and efficient protein import .

These findings demonstrate that specific amino acid residues in Tim23 are essential for maintaining proper channel function, and alterations can disrupt mitochondrial protein import with severe physiological consequences.

What can Tim23 mutations tell us about the mechanism of lateral release into the inner membrane?

Research on the TIM23 complex has provided insights into how proteins with hydrophobic stop-transfer signals are laterally released into the mitochondrial inner membrane:

• The import motor J-protein Pam18, which is essential for matrix import, controls lateral protein release into the lipid bilayer .

• When Pam18 is constitutively associated with the translocase, it obstructs lateral precursor transport .

• Mgr2, which is implicated in precursor quality control, is displaced from the translocase when Pam18 is present, suggesting these two proteins bind to the transport channel in a mutually exclusive manner during lateral transport of membrane proteins .

• The transmembrane segment of Pam18 appears to close the lateral gate of Tim23 during motor-dependent matrix protein transport, promoting anterograde polypeptide movement .

These findings explain why a motor-free form of the translocase facilitates the lateral movement of precursors with stop-transfer signals, revealing a regulatory mechanism for balancing the two transport modes (matrix import versus lateral release).

How conserved is Tim23 between Xenopus laevis and other species?

Tim23 is highly conserved across eukaryotic species, reflecting its essential role in mitochondrial protein import. Comparative analysis reveals:

• Core functional domains, particularly the channel-forming regions and substrate binding sites, show the highest degree of conservation.

• Xenopus laevis Tim23 (timm23b, Uniprot: Q6INU6) shares significant sequence homology with its counterparts in other vertebrates, including humans.

• The transmembrane domains that form the import channel and the regions involved in interactions with other TIM23 complex components show the highest conservation.

• The pore-lining amino acid residues that determine cation selectivity (such as N150, G153, L155, A156, and Y159 in yeast Tim23) are particularly well-conserved across species , suggesting evolutionary pressure to maintain the electrophysiological properties of the channel.

This conservation allows researchers to translate findings from model organisms to understand the function of Tim23 in higher vertebrates, including humans, where mitochondrial import defects are linked to various diseases.

Are there functional differences between Tim23 in Xenopus laevis and mammalian systems?

While the core functions of Tim23 are conserved between Xenopus laevis and mammalian systems, subtle differences may exist:

• Species-specific interactions: Tim23 may interact with different regulatory proteins or exhibit altered binding affinities in different species.

• Tissue-specific regulation: The regulation of Tim23 function may vary between amphibian and mammalian tissues, potentially reflecting differences in metabolic demands.

• Temperature dependence: As Xenopus laevis is a poikilothermic organism, its Tim23 may have evolved to function efficiently across a broader temperature range compared to mammalian homologs.

• Substrate specificity: While the general mechanism of import is conserved, the specific subset of proteins imported by Tim23 may vary between species based on their mitochondrial proteome.

Researchers should consider these potential differences when translating findings between amphibian and mammalian systems, particularly when studying temperature-sensitive processes or tissue-specific mitochondrial functions.

How can the split NanoLuc luciferase assay be optimized for studying Tim23-mediated import in Xenopus systems?

The split NanoLuc luciferase assay has revolutionized the study of mitochondrial protein import kinetics by providing improved sensitivity and time resolution. To optimize this assay for Xenopus systems:

• Design hybrid constructs containing Xenopus-specific mitochondrial targeting sequences fused to one fragment of NanoLuc (pep86), with the complementary fragment (11S) positioned either in the matrix or the inner membrane.

• Validate that the NanoLuc fragments do not interfere with normal import processes by comparing with traditional import assays.

• Establish baseline import kinetics under physiological conditions relevant to amphibian systems, including appropriate temperature ranges.

• Create a panel of precursor proteins with varying properties (size, charge, secondary structure) to systematically analyze how these factors influence import kinetics through Xenopus Tim23.

• Conduct comparative experiments under conditions that selectively inhibit either ΔΨ (using uncouplers) or ATP production (using oligomycin) to dissect the contribution of each driving force to import in the Xenopus system .

This optimized assay can provide insights into whether the two major rate-limiting steps identified in yeast (passage across the outer membrane and initiation of inner membrane transport) are conserved in vertebrate systems, and how they might be influenced by species-specific factors.

What experimental approaches can reveal the structural dynamics of Tim23 during protein transport?

Understanding the structural changes in Tim23 during protein transport requires sophisticated techniques:

• Single-molecule FRET (smFRET): By introducing fluorescent probes at strategic positions in Tim23, researchers can monitor conformational changes during protein transport in real-time.

• Cryo-electron microscopy: Recent advances in cryo-EM have made it possible to visualize membrane protein complexes at near-atomic resolution, potentially revealing the structure of Tim23 in different functional states.

• Site-directed crosslinking: Chemical crosslinking combined with mass spectrometry can identify dynamic protein-protein interactions during the transport process.

• Molecular dynamics simulations: Computational approaches can model how Tim23 might deform during protein passage, particularly how the channel might open laterally to release proteins into the membrane.

• Hydrogen-deuterium exchange mass spectrometry: This technique can identify regions of Tim23 that undergo structural changes during different stages of protein import.

These approaches, combined with functional assays, can provide a comprehensive understanding of how Tim23 dynamically reconfigures during protein transport, particularly during the transition between matrix import and lateral release functions.

What are the unresolved questions regarding Tim23's role in mitochondrial disease?

Several critical aspects of Tim23 function in disease contexts remain unresolved:

• The precise role of Tim23 dysfunction in mitochondrial diseases has not been fully characterized. How variations in Tim23 structure or abundance contribute to disease phenotypes requires further investigation.

• The potential for therapeutic targeting of the Tim23 complex to ameliorate mitochondrial import defects in disease states remains largely unexplored.

• The regulatory mechanisms that modulate Tim23 function under different physiological and pathological conditions are not completely understood.

• How Tim23 function changes during cellular aging and whether these changes contribute to age-related mitochondrial dysfunction remains an open question.

• The interplay between Tim23-mediated protein import and mitochondrial quality control mechanisms, particularly how import defects might trigger mitochondrial stress responses, represents an important area for future research.

How does Tim23 function adapt to changing cellular environments and stress conditions?

Understanding Tim23's adaptive responses is crucial for comprehending mitochondrial function under various physiological conditions:

• Research suggests that Tim23 function may be modulated in response to changes in cellular energy status, potentially through post-translational modifications or altered interactions with regulatory proteins.

• The composition of the TIM23 complex appears to be dynamic, with shifting associations between Tim23 and either motor components (for matrix import) or lateral gate regulators (for membrane sorting) .

• The apparent distinction between transport through the two membranes (TOM and TIM) challenges current models and suggests potential regulatory checkpoints that might be modulated under different conditions .

• The observation that precursor proteins spend very little time in the TIM23 channel suggests that rapid success or failure of import is critical for maintenance of mitochondrial fitness , raising questions about how this efficiency is maintained under stress conditions.

• The closing of the lateral gate by Pam18 during matrix protein transport reveals a regulatory mechanism for balancing the two transport modes , but how this balance is adjusted in response to cellular needs remains to be fully elucidated.

Future research directions should focus on integrating these molecular insights into a comprehensive understanding of how Tim23 function is regulated in response to cellular demands and how disruptions in this regulation contribute to disease states.