Recombinant Xenopus laevis Mitochondrial inner membrane protease subunit 2 (immp2l)

Shipped with Ice Packs
In Stock

Description

General Information

IMMP2L, or Inner Mitochondrial Membrane Peptidase subunit 2 Like, is a protein that resides in the inner mitochondrial membrane . It is involved in mitochondrial dynamics, cellular respiration, glycolysis, metabolism, and the production of mitochondrial reactive oxygen species . Studies suggest IMMP2L has a role in cellular homeostasis, NAD+ metabolism, and gene expression .

Structure and Function

IMMP2L functions as a peptidase, specifically affecting mitochondrial GPD2 dehydrogenase . Research indicates that IMMP2L enhances the structure and function of GPD2, which optimizes mitochondrial respiration .

Role in Disease

Intragenic deletions of IMMP2L may be genetic risk factors for Tourette syndrome . IMMP2L has also been identified as a candidate gene for autism susceptibility .

Research Findings

  • Association with Tourette Syndrome: Studies have identified intragenic deletions of IMMP2L in patients with Tourette syndrome, suggesting that these deletions may be genetic risk factors for the condition .

  • Association with Autism Spectrum Disorder (ASD): Meta-analysis did not indicate a general association between IMMP2L deletions and ASD .

  • Impact on Mitochondrial Function: IMMP2L plays a crucial role in enhancing the structure and function of mitochondrial GPD2 dehydrogenase, which optimizes and enhances mitochondrial respiration .

  • Role in Stem Cell Proliferation: IMMP2L cooperates with Lin28 to promote the proliferation of adult stem cells in the Drosophila intestine .

Mutation Distribution

IMMP2L mutations can be single base substitutions, complex mutations, or insertions and deletions . The COSMIC database provides a graphical view of mutations across the IMMP2L gene at the amino acid level .

Dosage Sensitivity

IMMP2L curation results for dosage sensitivity show that deletions in the IMMP2L gene have been observed in patients with Tourette syndrome and autism spectrum disorder . Some patients with intragenic IMMP2L deletions inherited the deletion from a parent, while others had de novo deletions .

Impact of IMMP2L Deficiency

IMMP2L deficiency impacts organ size, mitochondrial respiration, and non-mitochondrial respiration . Studies using IMMP2L knockout mouse models have provided insights into the role of IMMP2L in cellular homeostasis .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and approved in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. Please indicate your desired tag type at the time of ordering for preferential development.
Synonyms
immp2l; Mitochondrial inner membrane protease subunit 2; IMP2-like protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-170
Protein Length
full length protein
Species
Xenopus laevis (African clawed frog)
Target Names
immp2l
Target Protein Sequence
MAQHGRRYVRAFISGFFVAVPVTVTFLDRVACIARVEGVSMQPSLNPDARGESDIVLLNR WRARNYDVQRGDIVSLVSPKNPEQKIIKRVIALEGDIVKTLGHKNRYVKVPRGHVWVEGD HHGHSFDSNAFGPVSLGLLHSHATHILWPPNRWQKLKPFLPVERESVQND
Uniprot No.

Target Background

Function
This recombinant Xenopus laevis Mitochondrial inner membrane protease subunit 2 (IMMP2L) catalyzes the removal of transit peptides, a crucial step in targeting proteins from the mitochondrial matrix, across the inner membrane, and into the intermembrane space.
Database Links

KEGG: xla:495969

UniGene: Xl.48705

Protein Families
Peptidase S26 family, IMP2 subfamily
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein.

Q&A

What is the basic function of immp2l in Xenopus laevis?

Immp2l (Mitochondrial inner membrane protease subunit 2) in Xenopus laevis functions primarily as a peptidase involved in processing signal peptide sequences of mitochondrial proteins, particularly cytochrome c1 and glycerol phosphate dehydrogenase 2. This processing is essential for proper mitochondrial function and regulation of reactive oxygen species (ROS) generation. Mutation of the immp2l gene has been shown to impair normal signal peptide processing, resulting in elevated levels of superoxide ions and increased oxidative stress in multiple organs . The protein plays a crucial role in maintaining mitochondrial homeostasis and preventing premature cellular aging through its proteolytic activities that properly mature imported mitochondrial proteins.

What are the optimal methods for producing recombinant Xenopus laevis immp2l?

The production of recombinant Xenopus laevis immp2l typically involves:

  • Gene Cloning: The immp2l coding sequence (1-170 amino acids) is amplified from Xenopus laevis cDNA using PCR with specific primers designed based on the known sequence .

  • Expression Vector Construction: The amplified sequence is cloned into an appropriate expression vector (commonly pET or pGEX systems) with a suitable tag for purification (His-tag, GST-tag).

  • Expression Host Selection: E. coli BL21(DE3) is commonly used, though eukaryotic expression systems may be preferred for certain applications requiring post-translational modifications.

  • Expression Conditions: Optimization of induction conditions (IPTG concentration, temperature, duration) is critical for maximizing soluble protein yield.

  • Purification Strategy: Affinity chromatography (Ni-NTA for His-tagged proteins) followed by size exclusion chromatography is typically employed to obtain pure protein.

  • Storage: The purified protein is stored in Tris-based buffer with 50% glycerol at -20°C to -80°C to maintain stability and activity .

This approach yields typically 50 μg of purified protein per batch, though optimization can increase yields significantly.

What are the key considerations for designing immp2l knockout/mutation experiments in Xenopus?

When designing immp2l knockout or mutation experiments in Xenopus laevis, researchers should consider:

  • Genome Complexity: X. laevis has an allotetraploid genome, which complicates knockout strategies due to gene duplication. The latest genome assemblies (v10/v10.1) should be consulted to ensure accurate targeting of all relevant loci .

  • Genetic Editing Approach: CRISPR/Cas9 systems have been successfully adapted for Xenopus and are recommended for generating immp2l mutations. Multiple guide RNAs targeting conserved regions are often necessary .

  • Phenotype Assessment Timeline: Since immp2l mutations affect age-related phenotypes, studies should be designed to monitor animals throughout development and into adulthood, with particular attention to:

    • ROS levels in multiple tissues

    • Mitochondrial function parameters

    • Age-related phenotypes (sarcopenia, fat loss, kyphosis)

    • Sex-specific differences (females typically show earlier onset)

  • Controls: Due to the allotetraploid nature of X. laevis, appropriate controls including wild-type siblings and heterozygous mutants are essential to account for genetic background effects.

  • Tissue Specificity: Consider tissue-specific knockout approaches when studying organ-specific effects, as immp2l functions may vary across tissues.

What analytical techniques are most effective for studying immp2l activity and function?

The most effective analytical techniques for studying immp2l activity and function include:

  • Enzymatic Activity Assays:

    • Fluorogenic peptide substrate assays to measure proteolytic activity

    • In vitro processing assays using known substrate proteins (cytochrome c1, GPDA2)

  • Mitochondrial Function Analysis:

    • Oxygen consumption rate measurement

    • Membrane potential assessment using fluorescent dyes (TMRM, JC-1)

    • ATP production quantification

  • ROS Detection Methods:

    • Superoxide detection using MitoSOX or dihydroethidium

    • H₂O₂ quantification using Amplex Red assays

    • Protein carbonylation and lipid peroxidation as markers of oxidative damage

  • Protein Interaction Studies:

    • Immunoprecipitation coupled with mass spectrometry

    • Yeast two-hybrid screening

    • Proximity labeling techniques (BioID, APEX)

  • Subcellular Localization:

    • Immunofluorescence microscopy

    • Subcellular fractionation and Western blotting

    • Import assays using isolated mitochondria

These methods can be complemented with transcriptomic and proteomic approaches to gain comprehensive insights into immp2l function within the mitochondrial proteome network.

How does immp2l mutation affect oxidative stress pathways in different Xenopus tissues?

Immp2l mutation in Xenopus leads to tissue-specific alterations in oxidative stress pathways:

TissueROS ChangesAntioxidant ResponsePhenotypic Consequences
Brain↑ Superoxide levels↑ SOD expressionAtaxia, neurodegenerative changes
Kidney↑ ROS markers↑ Catalase activityRenal function impairment
Adipose↑ Oxidative damageImpaired antioxidant defenseLoss of subcutaneous fat
Muscle↑ Mitochondrial ROSVariable SOD responseSarcopenia, wasting
Gonads↑ Superoxide generationMinimal compensationImpaired fertility in both sexes

The mutation leads to increased oxidative stress across multiple organs, although compensatory upregulation of superoxide dismutases is observed in tissues like brain and kidney . Interestingly, the degree of oxidative stress and subsequent tissue damage shows sexual dimorphism, with female mutants exhibiting earlier onset and more severe age-associated disorders than males. This suggests that sex hormones or sex-specific factors modulate the oxidative stress response in immp2l-deficient animals . The differential tissue susceptibility appears related to both baseline metabolic rate and tissue-specific capacity for antioxidant defense upregulation.

What is the relationship between immp2l function and adult stem cell regulation in Xenopus models?

Immp2l function has significant implications for adult stem cell biology in Xenopus models. Research has demonstrated that:

  • Adipose-derived stromal cells (ADSCs) from immp2l mutant Xenopus exhibit impaired proliferation capability compared to wild-type controls.

  • Mutant ADSCs form significantly fewer and smaller colonies in colony formation assays, indicating compromised self-renewal capacity.

  • Despite proliferation defects, these cells retain adipogenic differentiation capability in vitro.

  • The functional impairment corresponds with increased levels of oxidative stress in the stem cell populations .

This relationship suggests that mitochondrial ROS generation, controlled in part by immp2l, acts as a critical regulator of stem cell function and may represent one mechanism by which immp2l mutations accelerate aging. The findings support the hypothesis that adult stem cell dysfunction contributes to age-associated disorders observed in immp2l mutants, including sarcopenia, loss of subcutaneous fat, and kyphosis . These observations establish Xenopus immp2l as an important model for studying the intersection of mitochondrial function, oxidative stress, and stem cell regulation in the context of aging.

How can immp2l studies in Xenopus inform understanding of human age-related disorders?

Studies of immp2l in Xenopus laevis provide valuable insights into human age-related disorders through several mechanisms:

  • Conserved Aging Pathways: Immp2l mutant Xenopus develop multiple aging-associated phenotypes that parallel human conditions, including wasting, sarcopenia, subcutaneous fat loss, kyphosis, and ataxia . The accelerated aging phenotype makes Xenopus an efficient model for studying interventions targeting age-related diseases.

  • Mitochondrial ROS Mechanisms: The direct causative relationship between mitochondrial ROS (due to immp2l dysfunction) and accelerated aging in Xenopus provides in vivo evidence supporting mitochondrial theories of aging in humans.

  • Stem Cell Dysfunction: Immp2l mutation in Xenopus impairs adult stem cell self-renewal, suggesting a mechanism for how mitochondrial dysfunction may contribute to diminished tissue regeneration in human aging .

  • Sex-Specific Aging Factors: The earlier onset and increased severity of aging phenotypes in female Xenopus mutants parallels sex differences in human longevity and disease susceptibility, offering a model to study these differences.

  • Translational Applications: Findings from Xenopus models can inform the development of mitochondria-targeted therapeutics for human age-related disorders, particularly those involving oxidative stress mechanisms.

The phylogenetic position of Xenopus between aquatic vertebrates and land tetrapods makes it particularly valuable for comparative studies, allowing researchers to distinguish conserved aging mechanisms from species-specific adaptations .

What are common challenges in expressing and purifying functional recombinant Xenopus immp2l?

Researchers face several challenges when working with recombinant Xenopus laevis immp2l:

  • Protein Solubility Issues: As a membrane-associated protein, immp2l often forms inclusion bodies when overexpressed. This can be mitigated by:

    • Lowering induction temperature (16-18°C)

    • Using solubility-enhancing tags (SUMO or MBP)

    • Adding low concentrations of detergents during lysis

  • Maintaining Enzymatic Activity: The proteolytic activity of immp2l is sensitive to purification conditions. Researchers should:

    • Include protease inhibitors selectively (avoiding those that might inhibit immp2l itself)

    • Maintain reducing conditions throughout purification

    • Optimize buffer composition for stability

  • Proper Folding Verification: Methods to verify proper folding include:

    • Circular dichroism spectroscopy

    • Limited proteolysis assays

    • Activity assays using synthetic peptide substrates

  • Storage Stability: Purified immp2l activity diminishes during storage. The recommended storage conditions include:

    • Tris-based buffer with 50% glycerol

    • Storage at -20°C or -80°C

    • Avoiding repeated freeze-thaw cycles

  • Proteolytic Self-Cleavage: As a protease, immp2l may undergo autoproteolysis during expression and storage, which can be monitored by SDS-PAGE and Western blotting.

How can researchers differentiate between direct and indirect effects of immp2l mutation in experimental systems?

Differentiating between direct and indirect effects of immp2l mutation requires systematic experimental approaches:

  • Complementation Studies: Reintroducing wild-type immp2l into mutant cells/organisms can confirm direct effects if the phenotype is rescued.

  • Substrate Identification: Using techniques such as:

    • SILAC proteomics comparing wild-type and mutant mitochondrial proteomes

    • In vitro processing assays with putative substrates

    • Proximity labeling to identify direct interacting partners

  • Temporal Analysis: Establishing the sequence of biochemical and physiological changes following immp2l mutation/knockdown to distinguish primary from secondary effects.

  • Pharmacological Approaches: Using:

    • Specific inhibitors of downstream pathways

    • Antioxidants to neutralize ROS (if secondary effects are ROS-mediated)

    • Mitochondrial-targeted compounds to distinguish compartment-specific effects

  • Tissue-Specific Manipulation: Using conditional or tissue-specific knockout/knockdown systems to isolate primary affected tissues from secondary systemic effects.

  • Mechanistic Biomarkers: Monitoring specific markers of immp2l activity (substrate processing) versus general markers of mitochondrial dysfunction to separate direct enzymatic consequences from broader cellular adaptations.

What controls are essential when studying the effects of recombinant immp2l in experimental systems?

Essential controls for recombinant immp2l studies include:

  • Enzymatic Activity Controls:

    • Inactive enzyme variant (site-directed mutagenesis of catalytic residues)

    • Heat-inactivated enzyme preparation

    • Known peptidase inhibitors as negative controls

  • Specificity Controls:

    • Closely related mitochondrial peptidases (e.g., IMMP1L)

    • Non-relevant proteins of similar size/structure

    • Substrate specificity verification using mutated substrates

  • Expression System Controls:

    • Empty vector controls in the same expression system

    • Wild-type versus mutant protein comparisons

    • Dose-response experiments with varying protein concentrations

  • Xenopus-Specific Controls:

    • Species-matched control proteins when studying Xenopus-specific interactions

    • Developmental stage-matched samples for developmental studies

    • Sex-matched controls given the sexual dimorphism in phenotypes

  • Technical Controls:

    • Protein purity verification by SDS-PAGE

    • Protein concentration normalization

    • Storage time-matched samples to control for activity loss during storage

Implementing these controls ensures that observed effects can be confidently attributed to immp2l activity rather than experimental artifacts or secondary mechanisms.

Why is Xenopus laevis particularly valuable for studying mitochondrial proteases like immp2l?

Xenopus laevis offers several advantages for mitochondrial protease research:

  • Evolutionary Significance: As a representative jawed vertebrate, Xenopus occupies a phylogenetically intermediate position between aquatic vertebrates and land tetrapods, making it valuable for evolutionary studies of mitochondrial function .

  • Developmental Accessibility: The external development and large size of Xenopus embryos facilitate:

    • Tracking mitochondrial protease expression during development

    • Visualizing mitochondrial dynamics in transparent embryos

    • Performing microinjection experiments with recombinant proteins or inhibitors

  • Genetic Tractability: Recent advances in Xenopus genome sequencing and annotation (v10/v10.1 assemblies) have improved the identification and characterization of mitochondrial genes .

  • Oocyte System: Xenopus oocytes provide a unique experimental system for studying mitochondrial biogenesis, as demonstrated in earlier studies on mitochondrial protein synthesis . This system allows for:

    • Distinction between mitochondrial and cytoplasmic protein synthesis

    • Study of immp2l's role in processing proteins synthesized in different compartments

    • Investigation of how immp2l contributes to mitochondrial membrane formation

  • Disease Modeling: The accelerated aging phenotype in immp2l mutant Xenopus provides an efficient model for studying age-related diseases linked to mitochondrial dysfunction .

How do the genomic features of Xenopus laevis affect immp2l research approaches?

The genomic characteristics of Xenopus laevis significantly impact immp2l research strategies:

  • Allotetraploidy: X. laevis has an allotetraploid genome resulting from an ancient whole-genome duplication, leading to:

    • Potential redundancy in immp2l genes requiring simultaneous targeting for complete knockout

    • Homeologous gene copies (L and S chromosomes) that may have subfunctionalized

  • Genome Assembly Advances: The evolution of genome assemblies has improved immp2l research:

    • Early assemblies (v7.1, v8.1) had limited coverage (~50%) and lacked contiguity

    • Newer assemblies (v10/v10.1) resolved many previous annotation issues, including identifying genes previously thought to be pseudogenes

  • Nomenclature Considerations: The X. laevis nomenclature convention designates homeologous chromosomes as L (long) and S (short), requiring researchers to consider:

    • Whether to target immp2l.L, immp2l.S, or both

    • Potential differential expression or function between homeologs

    • Appropriate naming in publications and databases

  • Comparative Genomics: Research benefits from comparing:

    • X. laevis (allotetraploid) with X. tropicalis (diploid)

    • Amphibian immp2l with mammalian orthologs

    • Syntenic relationships to understand evolutionary constraints

These genomic features necessitate careful experimental design and interpretation in Xenopus immp2l research, particularly for genetic manipulation approaches.

What emerging techniques are enhancing immp2l research in Xenopus systems?

Several cutting-edge methodologies are advancing immp2l research in Xenopus:

  • Genome Editing Advances:

    • CRISPR/Cas9 systems optimized for Xenopus enable precise immp2l manipulation

    • Base editing and prime editing techniques allow for specific point mutations

    • Inducible knockout systems permit temporal control of immp2l disruption

  • Single-Cell Technologies:

    • Single-cell RNA-seq reveals cell-type-specific effects of immp2l dysfunction

    • Spatial transcriptomics maps immp2l expression and downstream effects in tissues

    • Single-cell proteomics detects subtle changes in mitochondrial protein processing

  • Advanced Imaging:

    • Super-resolution microscopy visualizes immp2l localization within mitochondrial membranes

    • Intravital imaging tracks mitochondrial dynamics in live Xenopus tissues

    • FRET-based sensors monitor immp2l activity in real-time

  • Mitochondrial Isolation Innovations:

    • Improved protocols for isolating functional mitochondria from Xenopus tissues

    • Mitochondrial IP techniques for studying immp2l interactome

    • Organelle-specific proximity labeling for identifying immp2l substrates

  • Multi-omics Integration:

    • Combined proteomics, metabolomics, and transcriptomics approaches

    • Network analysis of immp2l-dependent pathways

    • Machine learning algorithms to predict immp2l substrates and interactions

These technological advances are enabling researchers to address previously intractable questions about immp2l function, regulation, and role in mitochondrial biology and age-related pathologies in Xenopus models.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.