Recombinant Xenopus laevis Mitoferrin-2A (slc25a28-a)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
slc25a28-a; mfrn2-a; Mitoferrin-2A; Mitochondrial iron transporter 2-A; Solute carrier family 25 member 28-A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-186
Protein Length
full length protein
Species
Xenopus laevis (African clawed frog)
Target Names
slc25a28-a
Target Protein Sequence
MELEAVLKERTAAAGDPGRVLGAWVRSGWSAAGPSVLESEGGSGGPLAFESTSSRILELA SKDNEPEYEALPDGSNVTTHMLAGAVAGVMEHCLMYPVDCVKTRMQSLQPDPAARYRNVM DALSKIVRTEGFWRPLRGLNVTATGAGPAHALYFACYEKLKKTLSDIIHPGGNSHIANGT DYSCPA
Uniprot No.

Target Background

Function
Mitoferrin-2A is a mitochondrial iron transporter mediating iron uptake. It is likely crucial for heme synthesis in hemoproteins and iron-sulfur cluster assembly in non-erythroid cells. The imported iron, presumably as Fe(II), is subsequently delivered to ferrochelatase to facilitate Fe(II) incorporation into protoporphyrin IX for heme production.
Database Links

KEGG: xla:444758

UniGene: Xl.57236

Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Mitoferrin-2A and what is its role in Xenopus laevis development?

Mitoferrin-2A (slc25a28-a) is a mitochondrial iron transporter that belongs to the solute carrier family 25. In Xenopus laevis, it functions as one of the principal importers of iron into the mitochondria. While Mitoferrin-1 is essential in erythroid cells with high iron demands, Mitoferrin-2A mediates mitochondrial iron import in non-erythroid cells . During Xenopus development, proper iron transport is critical as mitochondria are highly enriched in mature oocytes and are subsequently partitioned to newly-arising cells during embryogenesis . Iron availability impacts heme synthesis and iron-sulfur cluster assembly, which are essential for proper mitochondrial function during development.

Comparative properties of Mitoferrin-1 and Mitoferrin-2 in vertebrates:

PropertyMitoferrin-1 (SLC25A37)Mitoferrin-2A (SLC25A28-A)
Primary expressionErythroid cellsNon-erythroid cells
Chromosomal location (human)8p21.210q24.2
Protein length (human)338 aa364 aa
FunctionHigh-capacity iron importBasal iron import
RegulationGATA-1 dependentLess tissue-specific
Embryonic requirementEssential (lethal if absent)Redundant with Mitoferrin-1

How can I design effective experiments to study Mitoferrin-2A expression patterns in Xenopus embryos?

To effectively study Mitoferrin-2A expression patterns during Xenopus development, researchers should employ a multi-technique approach:

  • RNA expression analysis: Use slot-blot and Northern-blot hybridization with specific probes targeting slc25a28-a transcripts. Collect embryos at key developmental stages (unfertilized eggs, blastula, gastrula, neurula, tail-bud, organogenesis, hatching, and tadpole) .

  • Protein detection: Employ Western blotting using antibodies specific to Mitoferrin-2A. For quantification, generate a standard curve using known amounts of recombinant Mitoferrin-2A protein .

  • Temporal analysis: Compare expression between oocytes, eggs, and various embryonic stages to detect developmental regulation. It's critical to normalize to total RNA/protein content and consider the mitochondrial DNA content which remains relatively constant during early development .

  • Spatial analysis: Combine whole-mount in situ hybridization with tissue-specific markers to determine spatial expression patterns. This is particularly important given the differential expression of mitoferrins across tissues.

  • Functional validation: Consider loss-of-function studies using morpholinos or CRISPR targeting slc25a28-a to determine developmental consequences, ideally at stages showing peak expression .

Remember that total RNA extraction from Xenopus embryos requires careful staging, and larger oocytes (stages V and VI) may require mitochondrial isolation for accurate quantification due to high yolk protein content .

What are the key differences between Xenopus laevis Mitoferrin-2A and Mitoferrin-2B isoforms?

Xenopus laevis, being allotetraploid, possesses two mitoferrin-2 genes: slc25a28-a (Mitoferrin-2A) and slc25a28-b (Mitoferrin-2B). Understanding their differences is crucial for experimental design and data interpretation.

Comparative analysis of Mitoferrin-2A and Mitoferrin-2B in Xenopus laevis:

FeatureMitoferrin-2A (slc25a28-a)Mitoferrin-2B (slc25a28-b)
UniProt accessionQ6GLJ0Q68F18
Amino acid sequence variationsContains WVRSGWSAAGPSVLESEGGSGGContains WVRRGWATAGPGVLESDGGSGGT
TSSRILELA SKDNEPEYEALPDTSSSRILEL TSDNDPEYEALPE
NVTTHNVTAH
GNSHIANGTDYSCPAGNCHVANGIDNSCPA
Genomic originLikely a homeologLikely a homeolog
Structural featuresSimilar transmembrane domainsSimilar transmembrane domains

The sequence alignment reveals subtle amino acid differences that may result in functional variations between these paralogous proteins . When designing experiments targeting Mitoferrin-2 in Xenopus laevis, researchers must carefully consider these differences, particularly when:

  • Designing primers for PCR amplification or probes for hybridization

  • Developing antibodies for immunodetection

  • Interpreting knockdown or knockout phenotypes

  • Assessing potential compensatory mechanisms between paralogs

How does mitochondrial gene expression regulation during Xenopus development affect Mitoferrin-2A function?

Mitochondrial gene expression undergoes dramatic changes during Xenopus laevis development, which has significant implications for Mitoferrin-2A function. Research has established a clear pattern of developmental regulation that affects the mitochondrial environment in which Mitoferrin-2A operates.

Developmental dynamics of mitochondrial gene expression:

  • Early shutdown of mitochondrial transcription: Following fertilization, mitochondrial mRNAs decrease abruptly (by 5-10 fold) within hours and remain at very low levels until late neurula stages .

  • Differential stability of mitochondrial transcripts: While mRNAs decrease, mitochondrial rRNAs remain relatively stable due to different half-lives (approximately 50-60 hours for rRNAs versus 3 hours for mRNAs in Xenopus embryos) .

  • Resumption of mitochondrial activity: Mitochondrial RNA accumulation resumes at high rates during organogenesis, before the resumption of mitochondrial DNA replication .

These patterns suggest that Mitoferrin-2A function may be temporally regulated during development. Researchers should consider:

  • Analyzing Mitoferrin-2A protein stability and turnover rates at different developmental stages

  • Investigating post-translational modifications that might compensate for transcriptional downregulation

  • Examining potential iron storage mechanisms that maintain essential iron availability during periods of low mitochondrial gene expression

  • Considering the relationship between mitochondrial membrane potential changes and iron transport activity during early development

This developmental regulation represents a unique opportunity to study Mitoferrin-2A regulation in a dynamic physiological context.

What methodologies are most effective for examining Mitoferrin-2A protein interactions in Xenopus mitochondria?

Investigating protein interactions of Mitoferrin-2A requires specialized approaches due to its location in the mitochondrial inner membrane. The following methodologies are particularly effective:

  • Co-immunoprecipitation with mitochondrial fractionation:

    • Isolate intact mitochondria from Xenopus embryos or oocytes

    • Solubilize membranes with gentle detergents (digitonin, DDM, or CHAPS)

    • Perform pull-down with anti-Mitoferrin-2A antibodies or using tagged recombinant proteins

    • Analyze interacting partners by mass spectrometry

  • Proximity labeling approaches:

    • Express BioID or APEX2 fusions with Mitoferrin-2A in Xenopus embryos

    • Activate labeling at specific developmental stages

    • Purify biotinylated proteins and identify by mass spectrometry

  • FRET/BRET analysis with potential partners:

    • Focus on known mitochondrial iron homeostasis proteins

    • Particularly examine interactions with ferrochelatase and ABCB10, which form complexes with Mitoferrin-1 in other systems

  • Crosslinking mass spectrometry (XL-MS):

    • Use membrane-permeable crosslinkers

    • Identify interaction interfaces between Mitoferrin-2A and partners

  • Yeast two-hybrid membrane system variants:

    • Split-ubiquitin membrane yeast two-hybrid

    • MYTH (Membrane Yeast Two-Hybrid) system

When implementing these approaches, consider that:

  • The mitochondrial iron metabolism machinery is highly conserved across species

  • Interactions may be developmental stage-specific or iron-dependent

  • Xenopus egg extracts can be leveraged for in vitro reconstitution experiments

  • Careful design of fusion proteins is essential to preserve membrane topology and function

How can I effectively assess the functional impact of Mitoferrin-2A mutations on iron transport in Xenopus embryos?

To assess the functional impact of Mitoferrin-2A mutations on iron transport, researchers should utilize complementary approaches that address different aspects of iron homeostasis:

  • CRISPR/Cas9 genome editing:

    • Design sgRNAs targeting the slc25a28-a locus

    • Inject into Xenopus embryos at the one-cell stage along with Cas9 mRNA

    • Confirm editing efficiency via sequencing

    • Assess developmental phenotypes and rescue potential with wild-type or mutant mRNA

  • Morpholino-mediated knockdown:

    • Design translation-blocking or splice-blocking morpholinos

    • Validate knockdown efficiency by Western blotting

    • Perform rescue experiments to confirm specificity

  • Iron transport assays:

    • Isolate mitochondria from control and Mitoferrin-2A-depleted embryos

    • Measure 55Fe uptake in isolated mitochondria

    • Compare transport kinetics (Km and Vmax) between wild-type and mutant proteins

  • Mitochondrial iron quantification:

    • Use inductively coupled plasma mass spectrometry (ICP-MS) on isolated mitochondria

    • Apply colorimetric ferrozine assays for total iron content

    • Use Perls' Prussian blue staining for iron distribution in tissue sections

  • Metabolic impact assessment:

    • Measure activities of iron-dependent enzymes (aconitase, succinate dehydrogenase)

    • Analyze heme and iron-sulfur cluster protein levels

    • Assess oxygen consumption rates in isolated mitochondria

Recent developments in genetic code expansion in Xenopus embryos offer additional opportunities to introduce site-specific photocrosslinkable or photo-switchable amino acids into Mitoferrin-2A to study conformational changes associated with transport.

What are the technical challenges in producing and purifying functional recombinant Xenopus laevis Mitoferrin-2A?

Producing functional recombinant Mitoferrin-2A presents several technical challenges due to its nature as a multi-pass membrane protein. Researchers should consider the following approaches and limitations:

  • Expression system selection:

    • E. coli: While economical, proper folding of eukaryotic membrane proteins is problematic

    • Yeast (S. cerevisiae or P. pastoris): Better for eukaryotic membrane proteins, though glycosylation patterns differ

    • Insect cells: Improved folding and post-translational modifications

    • Mammalian cells: Optimal for folding but lower yields and higher costs

    • Cell-free systems: Allow direct incorporation into artificial membranes during synthesis

  • Construct design considerations:

    • Include fusion tags (His, FLAG, or GST) for purification

    • Consider introducing a TEV or PreScission protease site for tag removal

    • Terminal tags may interfere less with function than internal modifications

    • GFP fusion can monitor expression and folding quality

  • Solubilization and purification strategies:

    • Screen detergents systematically (DDM, LMNG, GDN)

    • Consider lipid nanodiscs or styrene maleic acid lipid particles (SMALPs) for native-like environment

    • Employ affinity chromatography followed by size exclusion chromatography

  • Functional validation approaches:

    • Reconstitute purified protein into proteoliposomes for transport assays

    • Complement yeast mitoferrin mutants (mrs3Δmrs4Δ) to assess functionality

    • Validate proper folding via circular dichroism spectroscopy

    • Confirm iron binding via isothermal titration calorimetry (ITC)

  • Storage and stability optimization:

    • Determine optimal detergent:protein ratios to prevent aggregation

    • Assess stability with various additives (glycerol, specific lipids)

    • Evaluate cryopreservation methods to maintain function

For structural studies, consider using the genetic ortholog screening approach to identify Mitoferrin-2A variants from related species with enhanced stability and expression characteristics.

How can I investigate the relationship between Mitoferrin-2A expression and mitochondrial metabolism during Xenopus development?

Investigating the relationship between Mitoferrin-2A expression and mitochondrial metabolism requires integration of molecular, biochemical, and imaging techniques:

  • Temporal correlation analysis:

    • Profile Mitoferrin-2A expression alongside key mitochondrial metabolic enzymes across developmental stages

    • Measure mitochondrial respiration rates (oxygen consumption) at corresponding stages

    • Analyze mitochondrial membrane potential changes using potential-sensitive dyes (TMRM, JC-1)

  • Metabolomic profiling:

    • Conduct targeted metabolomics focusing on TCA cycle intermediates

    • Analyze changes in ATP/ADP ratios and energy charge

    • Measure levels of iron-sulfur cluster-dependent metabolites

  • Mitochondrial dynamics assessment:

    • Track changes in mitochondrial morphology and distribution

    • Analyze fusion/fission dynamics during developmental transitions

    • Correlate with Mitoferrin-2A localization using fluorescent reporters

  • Hypoxia response pathway analysis:

    • Measure Hif-1α protein levels and activity as they relate to iron transport

    • Analyze the relationship between mitochondrial metabolism and organizer formation

    • Determine whether Mitoferrin-2A depletion affects hypoxia signaling

  • Integration with developmental signaling:

    • Investigate how developmental signaling pathways (Wnt/β-catenin) affect Mitoferrin-2A expression

    • Determine if iron availability via Mitoferrin-2A impacts developmental patterning genes

    • Examine cross-talk between mitochondrial metabolism and embryonic cell fate decisions

This integrated approach will provide insights into how Mitoferrin-2A contributes to the metabolic remodeling that occurs during embryonic development, particularly during the transition from maternal to zygotic control of metabolism.

What are the most informative experimental models for studying Mitoferrin-2A function in iron homeostasis disorders?

Several experimental models offer complementary insights into Mitoferrin-2A function in iron homeostasis disorders:

  • Xenopus embryo model:

    • Advantages: Rapid development, external fertilization, ease of manipulation

    • Applications: Developmental impacts of iron dysregulation, tissue-specific effects

    • Techniques: Morpholino knockdown, CRISPR/Cas9 editing, mRNA overexpression

    • Readouts: Developmental defects, hematological parameters, iron staining

  • Xenopus oocyte and egg extract systems:

    • Advantages: Biochemical accessibility, ability to study maternal factors

    • Applications: Mitochondrial isolation, iron transport assays, protein-protein interactions

    • Techniques: Extract fractionation, in vitro reconstitution, immunodepletion

    • Readouts: Iron transport kinetics, protein complex formation, mtDNA packaging dynamics

  • Cell culture models using Xenopus cells:

    • Advantages: Genetic manipulation, controlled environment

    • Applications: Iron challenge experiments, drug screening

    • Techniques: CRISPR editing, RNAi, reporter assays

    • Readouts: Iron content, metabolic shifts, mitochondrial function

  • Comparative model systems:

    • Zebrafish: Conserved hematopoietic development, live imaging capabilities

    • Mammalian systems: Higher translational relevance for human disease

    • Yeast: High-throughput genetic interaction studies with SLC25A28 orthologs

When designing experiments, consider that:

  • Complementation studies between species can reveal conserved functional domains

  • Combined loss of Mitoferrin-1 and Mitoferrin-2A may be necessary to observe strong phenotypes in non-erythroid tissues

  • The relationship between mitochondrial iron availability and hypoxia signaling has implications for cancer biology

How can advanced imaging techniques be optimized for studying Mitoferrin-2A localization and dynamics in Xenopus mitochondria?

Advanced imaging techniques offer powerful approaches for studying Mitoferrin-2A dynamics in Xenopus mitochondria, but require careful optimization:

  • Super-resolution microscopy:

    • STED microscopy: Achieves 20-30 nm resolution by selective depletion of fluorescence

      • Optimization: Use bright, photostable dyes (Atto647N, AbberiorSTAR dyes)

      • Challenge: Penetration depth in thick Xenopus embryo tissue

    • PALM/STORM: Single-molecule localization microscopy

      • Optimization: Use photoconvertible fluorophores (mEos, Dendra2) as Mitoferrin-2A fusions

      • Application: Quantify clustering and distribution in the inner membrane

  • Live-cell imaging approaches:

    • FRAP (Fluorescence Recovery After Photobleaching):

      • Design: Create Mitoferrin-2A-FP fusions with minimal functional impact

      • Measurement: Mobility and turnover rates within mitochondrial membranes

      • Controls: Compare with known mobile and immobile mitochondrial proteins

    • Single-particle tracking:

      • Approach: Use quantum dots or organic dyes with SNAP/CLIP tag fusions

      • Analysis: Diffusion coefficients and confinement zones

  • Correlative light and electron microscopy (CLEM):

    • Label Mitoferrin-2A with both fluorescent tags and electron-dense markers

    • Image the same sample by fluorescence microscopy followed by EM

    • Enables visualization of Mitoferrin-2A in the context of mitochondrial ultrastructure

  • Xenopus-specific considerations:

    • Sample preparation: Optimize clearing methods for deeper tissue imaging

    • Expression systems: Use genetic code expansion to incorporate minimal tags

    • Live embryo imaging: Design imaging chambers for long-term observation

    • Developmental timing: Consider stage-specific mitochondrial distributions

  • Quantitative analysis frameworks:

    • Develop computational approaches to track mitochondrial subpopulations

    • Implement machine learning algorithms for automated detection of distribution patterns

    • Correlate Mitoferrin-2A dynamics with mitochondrial functional states

Combining these approaches will provide unprecedented insights into how Mitoferrin-2A distribution and dynamics change during development and in response to iron availability fluctuations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.