Recombinant Xenopus laevis Mitoferrin-2B (slc25a28-b)

Shipped with Ice Packs
In Stock

Description

Introduction

Mitoferrin-2 (MFRN2), also known as solute carrier family 25 member 28 (SLC25A28), is a key mitochondrial iron transporter that regulates mitochondrial iron metabolism . It facilitates the transfer of cytosolic iron into mitochondria, a process vital for heme synthesis and iron-sulfur cluster assembly . In Xenopus laevis, the recombinant form, Mitoferrin-2B (slc25a28-b), is of particular interest in studies of angiogenesis, lymphangiogenesis, and other developmental processes .

General Information

Gene NameSLC25A28
AliasMitoferrin-2 (MFRN2)
OrganismXenopus laevis
FunctionTransports iron into mitochondria for various metabolic processes
Related PathwaysHeme synthesis, iron-sulfur cluster assembly

Functional Significance

Mitoferrin-2 plays a crucial role in cellular and mitochondrial iron homeostasis . It is essential for the biogenesis of iron-sulfur clusters and heme, which are critical components of various proteins involved in cellular respiration and other metabolic functions .

  • Iron Import: MFRN2 mediates the import of iron into mitochondria, which is required for synthesizing heme-containing proteins and Fe/S cluster assembly in non-erythroid cells .

  • Non-Erythroid Cells: Mitoferrin-2 is vital in non-erythroid cells, whereas mitoferrin-1 is essential when the demand for mitochondrial iron is high .

  • Regulation: Posttranscriptional mechanisms regulate the expression of mitoferrin-1 and mitoferrin-2 .

Research Findings

  • Pulmonary Fibrosis: MFRN2 is upregulated in alveolar type II epithelial cells (AECII) during pulmonary fibrosis, leading to mitochondrial iron deposition and cell injury . Overexpression of MFRN2 enhances mitochondrial iron deposition, resulting in mtDNA damage and decreased cell viability .

  • IREB2 Regulation: Iron regulatory element-binding protein 2 (IREB2) can upregulate MFRN2 expression. Studies show that increased IREB2 levels promote MFRN2 expression in cells injured by bleomycin (BLM) .

  • Therapeutic Target: Mitoferrin 2 (MFRN2) has been identified as a therapeutic target for chromosome 8p deleted cancers .

Xenopus Studies

Xenopus tadpoles have been utilized in chemical library screens to identify compounds and biological mechanisms involved in angiogenesis and lymphangiogenesis . These studies have identified several compounds that interfere with blood vascular and/or lymphatic development .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment based on availability.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, serving as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
slc25a28-b; mfrn2-b; Mitoferrin-2B; Mitochondrial iron transporter 2-B; Solute carrier family 25 member 28-B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-186
Protein Length
full length protein
Species
Xenopus laevis (African clawed frog)
Target Names
slc25a28-b
Target Protein Sequence
MELEAVLKERTAAAGDPGRVLGAWVRRGWATAGPGVLESDGGSGGTLAFESTSSSRILEL TSDNDPEYEALPEGSNVTAHMLAGAVAGVMEHCLMYPVDCVKTRMQSLQPDPAARYRNVM DALSKIVRTEGFWRPLRGLNVTATGAGPAHALYFACYEKLKKTLSDIIHPGGNCHVANGI DNSCPA
Uniprot No.

Target Background

Function

Mitoferrin-2B is a mitochondrial iron transporter mediating iron uptake. It is likely crucial for heme synthesis in hemoproteins and Fe-S cluster assembly in non-erythroid cells. The iron, presumably delivered as Fe2+, is then likely transferred to ferrochelatase to catalyze the incorporation of Fe2+ into protoporphyrin IX for heme production.

Database Links

KEGG: xla:447330

UniGene: Xl.80320

Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Mitoferrin-2B (slc25a28-b) and what is its primary function in Xenopus laevis?

Mitoferrin-2B (slc25a28-b) is a mitochondrial iron transporter protein belonging to the solute carrier family 25, member 28-B. In Xenopus laevis, this protein plays a crucial role in iron homeostasis by facilitating iron import into mitochondria. The full-length protein consists of 186 amino acids and functions as part of the cellular machinery responsible for iron metabolism . As iron is essential for various metabolic processes including heme synthesis and iron-sulfur cluster formation, Mitoferrin-2B is likely involved in developmental processes and cellular respiration in Xenopus laevis, similar to its function in other vertebrates. The protein is encoded by the slc25a28-b gene, which has synonyms including mfrn2-b and is identified by UniProt ID Q68F18 .

What are the optimal storage and reconstitution conditions for maintaining Mitoferrin-2B activity?

For optimal retention of Mitoferrin-2B activity, researchers should follow these evidence-based storage and reconstitution protocols:

Storage conditions:

  • Store lyophilized protein at -20°C to -80°C upon receipt

  • Aliquot reconstituted protein to avoid repeated freeze-thaw cycles

  • Working aliquots can be stored at 4°C for up to one week

  • For long-term storage, add glycerol to a final concentration of 5-50% (50% is recommended) and store at -20°C to -80°C

Reconstitution protocol:

  • Briefly centrifuge the vial prior to opening to collect contents at the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • The protein is supplied in a Tris/PBS-based buffer containing 6% trehalose at pH 8.0, which helps maintain stability

It's important to note that repeated freeze-thaw cycles significantly reduce protein activity and should be avoided through proper aliquoting after initial reconstitution.

Why is Xenopus laevis a valuable model for studying mitochondrial iron transport proteins?

Xenopus laevis offers several unique advantages for studying mitochondrial iron transport proteins like Mitoferrin-2B:

  • Evolutionary position: As an amphibian, Xenopus occupies a phylogenetically intermediate position between aquatic vertebrates and land tetrapods, allowing comparative studies of conserved mechanisms across vertebrate evolution .

  • Experimental accessibility: The large, abundant eggs and readily manipulated embryos facilitate various experimental approaches, including microinjection of mRNAs or morpholinos targeting Mitoferrin-2B .

  • Developmental biology applications: Xenopus embryos develop externally and rapidly, enabling real-time observation of iron transport during developmental processes .

  • Conserved genomic organization: Xenopus shares conserved cellular, developmental, and genomic organization with mammals, making findings potentially translatable to human biology .

  • Cell-free systems: Xenopus egg extracts can be used to study mitochondrial protein function in a controlled biochemical environment .

While X. laevis is allotetraploid (with potential gene duplications), researchers can use X. tropicalis (diploid) as a complementary model when genetic manipulation is required .

What methodologies are most effective for studying iron transport function of Mitoferrin-2B in Xenopus embryonic development?

For investigating Mitoferrin-2B's role in iron transport during Xenopus embryonic development, researchers should consider these methodological approaches:

Functional analysis approaches:

  • Morpholino-mediated knockdown: Antisense morpholino oligonucleotides can be designed to target slc25a28-b mRNA. These can be microinjected into early embryos to study loss-of-function phenotypes related to iron transport deficiency .

  • mRNA overexpression: Microinjection of synthesized mRNA encoding wildtype or mutant forms of Mitoferrin-2B can be used for gain-of-function or dominant negative studies .

  • CRISPR/Cas9 genome editing: While traditionally challenging in X. laevis due to its allotetraploid genome, targeted mutagenesis can be accomplished (particularly in X. tropicalis) to create genetic models of Mitoferrin-2B dysfunction .

Iron transport assessment techniques:

  • Radioactive iron (⁵⁵Fe) uptake assays: To directly measure mitochondrial iron import in isolated mitochondria from Xenopus embryos at different developmental stages.

  • Fluorescent iron sensors: Genetically-encoded or chemical probes can be used to visualize iron distribution in living embryos.

  • Whole mount in situ hybridization: To examine spatial and temporal expression patterns of slc25a28-b during development.

  • Biochemical fractionation: To assess iron content in mitochondrial versus cytosolic compartments using spectrophotometric methods or inductively coupled plasma mass spectrometry (ICP-MS).

For developmental phenotyping, researchers should monitor hematological parameters, as iron deficiency would affect hemoglobin synthesis during tadpole development.

How can structure-function relationships of Mitoferrin-2B be investigated using recombinant protein?

Structure-function relationship studies of Mitoferrin-2B can be conducted using the following systematic approaches:

1. Domain mapping and mutagenesis:

  • Generate truncated versions or site-directed mutants of the recombinant protein

  • Focus on conserved regions identified through sequence alignment with Mitoferrin homologs

  • Express mutant constructs in systems lacking endogenous Mitoferrin activity

  • Assess functional impact on iron transport using radioactive iron uptake assays or complementation studies

2. Protein interaction studies:

  • Use recombinant His-tagged Mitoferrin-2B for pull-down assays to identify binding partners

  • Employ techniques like co-immunoprecipitation following in vitro translation in Xenopus egg extracts

  • Validate interactions through surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC)

3. Reconstitution in artificial membrane systems:

  • Incorporate purified recombinant Mitoferrin-2B into liposomes or nanodiscs

  • Measure direct transport activity using iron-sensitive fluorescent dyes

  • Determine kinetic parameters (Km, Vmax) for iron transport

4. Structural biology approaches:

  • Generate protein crystals for X-ray crystallography

  • Use cryo-electron microscopy for structural determination

  • Apply molecular dynamics simulations to predict conformational changes during transport

The amino acid sequence data available for the recombinant protein (186 amino acids) provides a foundation for designing these experiments, enabling precise targeting of functionally important residues .

What experimental challenges might researchers encounter when designing knockdown experiments targeting slc25a28-b in Xenopus?

Researchers targeting slc25a28-b in Xenopus face several technical challenges that require careful experimental design:

1. Genome duplication considerations:

  • Xenopus laevis has an allotetraploid genome, potentially containing duplicate copies of slc25a28-b

  • Complete knockdown may require targeting multiple paralogs simultaneously

  • X. tropicalis (diploid) may offer a simpler genetic background for clean knockdown studies

2. Morpholino design and validation:

  • Morpholinos are effective for the first few days of development but have temporal limitations

  • Careful design to avoid off-target effects is essential

  • Western blotting with specific antibodies should verify protein reduction

  • Rescue experiments with morpholino-resistant mRNA constructs are necessary to confirm specificity

3. Functional redundancy:

  • Other mitochondrial iron transporters might compensate for Mitoferrin-2B loss

  • May require simultaneous knockdown of multiple transporters

  • Consider tissue-specific effects where compensation mechanisms might differ

4. Developmental timing:

  • Early embryonic lethality might obscure later phenotypes

  • Consider using inducible or tissue-specific knockdown strategies

  • Employ partial knockdowns to study hypomorphic phenotypes

5. Phenotypic assessment:

  • Iron-related phenotypes may be subtle or manifest only under iron stress conditions

  • Combine molecular, cellular, and physiological readouts

  • Use complementary approaches like CRISPR/Cas9 mutagenesis for validation

Using antisense oligonucleotides has previously yielded insights into developmental pathways in Xenopus, such as the β-catenin signaling pathway, providing precedent for successful knockdown strategies .

How can researchers distinguish between the functions of Mitoferrin-2B and other mitochondrial iron transporters in Xenopus?

Distinguishing between the functions of different mitochondrial iron transporters in Xenopus requires a multi-faceted experimental approach:

1. Expression pattern analysis:

  • Perform quantitative RT-PCR to determine tissue-specific and developmental stage-specific expression patterns

  • Use in situ hybridization to visualize spatial expression differences

  • Generate reporter constructs with promoters from different transporters

2. Substrate specificity determination:

  • Conduct in vitro transport assays using purified recombinant proteins

  • Test different metal ions beyond iron (zinc, copper, manganese) to identify transporter preferences

  • Determine kinetic parameters for different substrates

3. Selective genetic manipulation:

  • Design highly specific morpholinos or CRISPR/Cas9 guide RNAs targeting unique sequences

  • Create transporter-specific dominant negative constructs by mutating key residues

  • Perform selective rescue experiments with different transporters

4. Protein interaction network mapping:

  • Identify transporter-specific binding partners through proteomics approaches

  • Investigate whether transporters form distinct complexes with different auxiliary proteins

  • Determine if transporters localize to different mitochondrial subcompartments

5. Physiological response assessment:

  • Investigate differential responses to iron deficiency or overload

  • Examine transporter regulation under various stress conditions

  • Assess tissue-specific phenotypes following selective knockdown

Using the well-characterized Xenopus model system with its genetic and genomic tools enables these comparative approaches to reveal the distinct roles of Mitoferrin-2B versus other iron transporters .

What experimental approaches can determine if Mitoferrin-2B interacts with heme biosynthesis pathways in Xenopus development?

To investigate potential interactions between Mitoferrin-2B and heme biosynthesis during Xenopus development, researchers should consider this systematic experimental workflow:

1. Co-expression analysis:

  • Perform temporal expression profiling of Mitoferrin-2B alongside key heme biosynthesis enzymes (ALAS, FECH, etc.)

  • Use single-cell RNA sequencing of developing embryos to identify cell populations with coordinated expression

  • Generate reporter lines for simultaneous visualization of expression patterns

2. Metabolic impact studies:

  • Measure heme synthesis rates in embryos with Mitoferrin-2B knockdown/overexpression

  • Quantify heme precursor accumulation using chromatography and mass spectrometry

  • Assess activity of iron-dependent enzymes in the heme biosynthetic pathway

3. Protein-protein interaction mapping:

  • Perform co-immunoprecipitation with tagged Mitoferrin-2B to identify interactions with heme biosynthesis enzymes

  • Use proximity labeling approaches (BioID, APEX) in Xenopus embryos to identify proteins in close proximity to Mitoferrin-2B

  • Validate direct interactions through in vitro binding assays with purified recombinant proteins

4. Subcellular co-localization:

  • Generate fluorescently tagged fusion proteins to visualize Mitoferrin-2B localization relative to heme biosynthesis enzymes

  • Use super-resolution microscopy to determine precise spatial relationships

  • Perform fractionation studies to biochemically confirm co-localization

5. Rescue experiments:

  • Test if heme or heme precursors can rescue phenotypes caused by Mitoferrin-2B deficiency

  • Evaluate if overexpression of heme biosynthesis enzymes can compensate for Mitoferrin-2B knockdown

Since Xenopus has been used extensively for developmental biology and cell biological studies, these approaches can leverage the system's strengths while providing mechanistic insights into iron utilization pathways .

What quality control measures should be implemented when working with recombinant Mitoferrin-2B?

To ensure experimental reliability and reproducibility when working with recombinant Mitoferrin-2B, researchers should implement the following quality control measures:

1. Protein integrity verification:

  • SDS-PAGE analysis to confirm the expected molecular weight (purity should exceed 90%)

  • Western blotting with anti-His antibodies to verify tag presence

  • Mass spectrometry to confirm protein identity and detect potential modifications

  • Circular dichroism spectroscopy to assess proper protein folding

2. Functional activity assessment:

  • Iron binding assays using isothermal titration calorimetry

  • Reconstitution into proteoliposomes to verify transport activity

  • Complementation assays in yeast mitoferrin-deficient strains

3. Stability monitoring:

  • Real-time stability testing under various storage conditions

  • Thermal shift assays to determine protein stability

  • Limited proteolysis to assess structural integrity

  • Dynamic light scattering to detect aggregation

4. Batch consistency checks:

  • Establish standard reference samples for batch-to-batch comparison

  • Maintain detailed records of expression conditions and purification procedures

  • Implement consistent quality thresholds for experimental use

5. Endotoxin testing:

  • For cell-based applications, verify endotoxin levels are below acceptable thresholds

  • Use endotoxin removal methods if necessary

Quality control benchmarks for recombinant Mitoferrin-2B:

ParameterSpecificationMethodFrequency
Purity>90%SDS-PAGEEach batch
IdentityMatch to expected sequenceMass spectrometryEach new preparation
Tag presencePositive signalWestern blot (anti-His)Each batch
Endotoxin level<0.1 EU/μg proteinLAL assayEach batch
Functional activityTransport activity >80% of standardIron transport assayEach batch
Stability<10% degradationSDS-PAGE after incubationEach storage condition

Regular implementation of these quality control measures ensures that experimental outcomes reflect true biological phenomena rather than artifacts from protein degradation or inactivity .

How can researchers optimize transfection of Mitoferrin-2B constructs in Xenopus oocytes and embryos?

Optimizing transfection of Mitoferrin-2B constructs in Xenopus systems requires different approaches for oocytes versus embryos:

For Xenopus oocytes:

  • Microinjection technique:

    • Use glass capillary needles with 10-20 μm tip diameter

    • Inject 50-100 nl of capped mRNA (concentration 0.1-1 μg/μl)

    • Target the animal hemisphere for nuclear-destined constructs

    • Allow 24-48 hours for optimal protein expression

  • Expression vector selection:

    • Use vectors containing Xenopus β-globin 5' and 3' UTRs for enhanced stability

    • Include a Kozak consensus sequence for efficient translation

    • Consider oocyte-specific promoters for DNA constructs

  • Electrophysiological recording optimization:

    • For functional studies, maintain oocytes at 18°C in antibiotic-containing media

    • Record 2-5 days post-injection for optimal expression

    • Use two-electrode voltage clamp for transport measurements

For Xenopus embryos:

  • Microinjection parameters:

    • Inject at 1-2 cell stage (within 90 minutes post-fertilization)

    • Use 2-10 nl volume with mRNA concentration of 50-500 pg/nl

    • Target specific blastomeres for tissue-restricted expression

    • Co-inject with lineage tracers (e.g., fluorescent dextrans)

  • Alternative methods:

    • I-SceI meganuclease-mediated transgenesis for genomic integration

    • Transposase-mediated integration for stable expression

    • Lipofection can be used for targeted transfection of later stage embryos

  • Expression verification:

    • Include reporter tags (GFP, mCherry) for visualization

    • Western blotting of embryo lysates at different timepoints

    • Whole-mount immunohistochemistry for spatial expression pattern

Xenopus oocytes have historically served as an excellent expression system for transporters and channels, making them particularly suitable for functional studies of Mitoferrin-2B .

How do functional studies of Mitoferrin-2B in Xenopus compare with studies in mammalian systems?

When comparing Mitoferrin-2B studies between Xenopus and mammalian systems, researchers should consider several key differences and complementary advantages:

Structural and functional conservation:

  • Xenopus Mitoferrin-2B and mammalian Mitoferrin-2 share significant sequence homology, suggesting conserved core functions

  • Both are members of the solute carrier family 25 (SLC25A28)

  • Both localize to the inner mitochondrial membrane and function in iron transport

Experimental advantages of Xenopus:

  • Developmental accessibility:

    • External embryonic development allows direct observation and manipulation

    • Larger cell size facilitates microinjection and subcellular imaging

    • Ability to generate thousands of synchronized embryos for biochemical studies

  • Unique methodological approaches:

    • Xenopus oocytes provide an established system for electrophysiological recording of transporter activity

    • Cell-free extracts from Xenopus eggs enable biochemical reconstitution studies

    • Blastomere isolation permits functional assessment in specific cell lineages

Advantages of mammalian systems:

  • Closer evolutionary relationship to humans:

    • More directly relevant for biomedical applications

    • Conserved regulatory networks and interaction partners

  • Available genetic tools:

    • Extensive collections of knockout and knockin mouse models

    • Well-established mammalian cell culture systems with CRISPR screening capabilities

Comparative experimental design:

  • Use Xenopus for initial functional characterization and high-throughput screening

  • Validate key findings in mammalian cell lines and mouse models

  • Capitalize on Xenopus for mechanistic studies requiring embryological manipulations

  • Leverage mammalian systems for physiological integration and disease modeling

Xenopus research has historically provided fundamental insights that predated confirmatory findings in mammals, suggesting its continued value in understanding novel aspects of Mitoferrin-2B function .

What insights can evolutionary analysis of Mitoferrin-2B across species provide about its functional domains?

Evolutionary analysis of Mitoferrin-2B across species can reveal critical insights about functional domains and conserved mechanisms of action:

1. Sequence conservation patterns:

  • Multiple sequence alignment of Mitoferrin-2B from fish to mammals can identify:

    • Invariant residues likely essential for core transport function

    • Variable regions that may confer species-specific regulation

    • Lineage-specific insertions or deletions with potential functional significance

2. Phylogenetic relationships:

  • Construction of phylogenetic trees can reveal:

    • Duplication events leading to paralogous transporters

    • Rates of evolutionary change across different lineages

    • Correlation between sequence divergence and environmental adaptations

3. Structural conservation mapping:

  • Homology modeling based on crystallized transporters in the same family can identify:

    • Conserved transmembrane domains forming the transport channel

    • Substrate binding sites with high evolutionary constraint

    • Regulatory domains subject to species-specific selection

4. Functional domain prediction:

  • Evolutionary trace methods can identify:

    • Co-evolving residues indicating functional interaction networks

    • Functional motifs conserved across the mitochondrial carrier family

    • Potential interaction surfaces with partner proteins

5. Selection pressure analysis:

  • Calculation of dN/dS ratios can reveal:

    • Domains under purifying selection (functionally constrained)

    • Regions under positive selection (potentially adapting to different iron requirements)

    • Lineage-specific selection patterns

The evolutionary position of Xenopus between aquatic vertebrates and land tetrapods makes it particularly valuable for identifying conserved versus derived features of Mitoferrin-2B function . This comparative approach can guide the design of targeted mutagenesis experiments to test functional hypotheses.

How can studies of Xenopus Mitoferrin-2B contribute to understanding human mitochondrial iron disorders?

Research on Xenopus Mitoferrin-2B offers valuable insights into human mitochondrial iron disorders through multiple translational pathways:

1. Functional conservation relevance:

  • Human and Xenopus Mitoferrin proteins share conserved functional domains

  • Mechanisms of iron transport across the inner mitochondrial membrane are evolutionarily conserved

  • This conservation allows modeling of human disease-associated mutations in the Xenopus system

2. Disease mechanism modeling:

  • Xenopus embryos can be manipulated to mimic conditions seen in:

    • Sideroblastic anemias (characterized by mitochondrial iron overload)

    • Friedreich's ataxia (involving mitochondrial iron dysregulation)

    • Various mitochondrial myopathies with iron metabolism components

  • Using morpholinos or CRISPR-based approaches to create loss-of-function phenotypes that parallel human conditions

3. High-throughput screening applications:

  • Xenopus embryos can be used to screen:

    • Compounds that correct iron transport deficiencies

    • Genetic modifiers of Mitoferrin-2B function

    • Factors that enhance or rescue mitochondrial iron homeostasis

4. Mechanistic insights from embryological studies:

  • Developmental consequences of Mitoferrin dysfunction can reveal:

    • Critical periods where iron transport is essential

    • Tissue-specific requirements for mitochondrial iron

    • Compensatory mechanisms that might be therapeutically relevant

5. Xenopus-specific experimental advantages:

  • Large-scale biochemical studies feasible with Xenopus egg extracts

  • Tissue-specific knockdown possible through targeted microinjection

  • Rapid assessment of phenotypes due to external development

The phylogenetic position of Xenopus as a tetrapod vertebrate with conserved cellular and developmental organization with mammals enhances the translational relevance of findings to human disease contexts .

What methodological approaches can assess Mitoferrin-2B involvement in iron-dependent developmental processes?

To investigate Mitoferrin-2B's role in iron-dependent developmental processes, researchers can employ these methodological approaches tailored to the Xenopus model system:

1. Spatiotemporal expression mapping:

  • Whole-mount in situ hybridization to visualize slc25a28-b expression patterns throughout development

  • Immunohistochemistry with anti-Mitoferrin-2B antibodies to track protein localization

  • Transgenic reporter lines with the slc25a28-b promoter driving fluorescent protein expression

  • Quantitative RT-PCR on dissected tissues to measure expression levels at key developmental stages

2. Loss-of-function approaches:

  • Targeted microinjection of morpholinos against slc25a28-b into specific blastomeres

  • CRISPR/Cas9-mediated mutagenesis (particularly effective in X. tropicalis)

  • Dominant negative constructs designed to interfere with endogenous Mitoferrin-2B function

  • Pharmacological inhibitors of mitochondrial iron transport

3. Rescue and gain-of-function studies:

  • mRNA rescue experiments with wild-type or mutant Mitoferrin-2B

  • Iron supplementation to bypass transport defects

  • Transgenic overexpression to evaluate effects of increased mitochondrial iron import

4. Iron-dependent process assessment:

  • Hemoglobin synthesis measurement using o-dianisidine staining

  • Activity assays for iron-sulfur cluster-containing enzymes

  • Mitochondrial respiration measurement in isolated mitochondria

  • Iron staining techniques (Perls' Prussian blue) to visualize iron accumulation

  • Fluorescent iron sensors for dynamic iron imaging in living embryos

5. Integration with developmental staging:

  • Targeted analysis at key developmental transitions (gastrulation, neurulation, organogenesis)

  • Metamorphosis studies examining changes in iron requirements during this iron-demanding process

  • Lineage tracing combined with iron transport assessment in specific tissue derivatives

These approaches leverage the unique advantages of the Xenopus system, including external development, ease of manipulation, and embryological accessibility, to provide comprehensive insights into the developmental functions of Mitoferrin-2B .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.