Recombinant Xenopus laevis NADH-ubiquinone oxidoreductase chain 3 (mt-nd3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipments.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
mt-nd3; mtnd3; nadh3; nd3; NADH-ubiquinone oxidoreductase chain 3; NADH dehydrogenase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-114
Protein Length
full length protein
Species
Xenopus laevis (African clawed frog)
Target Names
Target Protein Sequence
MTATILMIAMTLSTILAILSFWLPQMTPDMEKLSPYECGFDPLGSMRLPFSMRFFLIAIL FLLFDLEIALLLPFPWAAQLNTPSIVILWAALILTLLTLGLIYEWLQGGLEWAE
Uniprot No.

Target Background

Function

A core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), this protein is considered part of the minimal assembly required for catalytic activity. Complex I facilitates electron transfer from NADH to the respiratory chain, with ubiquinone believed to be the immediate electron acceptor.

Database Links

KEGG: xla:2642085

Protein Families
Complex I subunit 3 family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

What is the mt-nd3 gene in Xenopus laevis and what is its function?

The mt-nd3 gene in Xenopus laevis encodes the NADH-ubiquinone oxidoreductase chain 3, which is a core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). This protein plays an essential role in electron transfer from NADH through the respiratory chain, using ubiquinone as an electron acceptor. The mt-nd3 gene product is critical for the catalytic activity of complex I, which is a key component of oxidative phosphorylation.

Similar to its human homolog (MT-ND3), the Xenopus laevis mt-nd3 is involved in mitochondrial electron transport, specifically in the pathway from NADH to ubiquinone . This process is fundamental for cellular energy production through ATP synthesis.

How is mt-nd3 expression regulated during Xenopus laevis development?

The expression of mt-nd3, like other mitochondrial genes in Xenopus laevis, follows a specific pattern during embryonic development. Studies show that mt-nd3 transcript levels decrease significantly after fertilization (by a factor of 5-10), remain at very low levels up to the late neurula stages, and then increase again during organogenesis .

This regulation pattern is part of a coordinated mechanism affecting all mitochondrial genes simultaneously. Unlike mitochondrial ribosomal RNAs (12S and 16S) which maintain relatively constant levels throughout early development, mt-nd3 and other mitochondrial mRNAs show this distinct pattern of initial decrease followed by a later increase .

What challenges exist in detecting mt-nd3 transcripts in Xenopus laevis?

The detection of mt-nd3 transcripts in Xenopus laevis presents specific technical challenges for researchers. The mt-nd3 transcript (0.34 kb) produces a faint signal that is difficult to visualize on photographs without over-exposure . This technical limitation requires optimization of detection methods, including:

  • Increased RNA loading for Northern blot analysis (20 μg or more)

  • Longer exposure times for autoradiographs

  • Higher sensitivity detection systems for low-abundance transcripts

  • Use of specific DNA probes with high affinity for the mt-nd3 sequence

These challenges highlight the importance of optimized protocols when studying low-abundance mitochondrial transcripts like mt-nd3.

How do mitochondrial transcription patterns in Xenopus compare with other vertebrate models?

The mitochondrial transcription patterns observed in Xenopus laevis development show interesting parallels with other vertebrate models, particularly mice. In mouse embryos, researchers have observed a progressive decline in mitochondrial rRNAs and mRNAs between the late oocyte stage and the 2-cell embryo, with activation of mitochondrial genome transcription occurring at the 4-8 cell stage .

The key similarities and differences include:

FeatureXenopus laevisMouse
Initial decrease in mt mRNAs5-10 fold decrease after fertilization2.5-fold decrease after fertilization
Timing of transcription activationAfter mid-blastula transitionAt 4-8 cell stage
Regulation mechanismCoordinated on/off switch affecting all mt genesSimilar coordinated regulation
mtDNA contentStable during early developmentStable up to blastocyst stage

These comparative patterns suggest a possibly conserved regulatory mechanism for mitochondrial gene expression during early vertebrate development, though with species-specific variations in magnitude and timing .

What molecular techniques are most effective for studying recombinant Xenopus laevis mt-nd3?

For the effective study of recombinant Xenopus laevis mt-nd3, several molecular techniques have proven particularly valuable:

  • Next-Generation Sequencing (NGS): NGS technology allows quantitative analysis of heteroplasmic mutant load by counting mtDNA reads, which is especially useful for studying variations in mt-nd3 .

  • Northern Blot Hybridization: This technique allows visualization of mt-nd3 transcripts using specific 32P-labelled probes, though higher RNA amounts (20 μg) are needed due to the low abundance of the transcript .

  • Slot-Blot Hybridization: This method can be used for quantitative assessment of mt-nd3 transcript levels using specific probes, with 1.5-2 μg of RNA needed for messenger probes .

  • Recombinant Protein Expression Systems: For functional studies, researchers can use bacterial or eukaryotic expression systems to produce recombinant mt-nd3 protein for biochemical and structural analyses .

Each technique has specific advantages depending on the research question, with NGS offering the most comprehensive genomic information and Northern blots providing transcript-specific data.

How do mutations in mt-nd3 affect mitochondrial complex I function in model organisms?

Mutations in mt-nd3 can significantly impact mitochondrial complex I function, as observed in both human patients and model organisms. The effects include:

  • Disrupted Electron Transport: Mutations can impair NADH dehydrogenase activity, reducing electron transfer efficiency through the respiratory chain.

  • Altered Complex I Assembly: Some mutations affect the proper assembly of complex I, leading to structural abnormalities and decreased stability.

  • Increased ROS Production: Dysfunctional complex I often results in increased reactive oxygen species production, causing oxidative stress.

  • Energy Deficiency: The ultimate consequence is typically reduced ATP production, affecting energy-dependent cellular processes.

In humans, specific mutations in MT-ND3 (such as m.10191T>C) have been associated with Leigh Syndrome and epilepsy . While direct data from Xenopus models is limited in the provided search results, the conservation of mitochondrial function across species suggests similar pathological mechanisms would apply.

What are the optimal protocols for detecting low-abundance mt-nd3 transcripts in developmental studies?

For detecting low-abundance mt-nd3 transcripts during Xenopus development, the following optimized protocol components are essential:

  • RNA Extraction and Preparation:

    • Extract total RNA from unfertilized eggs and embryos at various developmental stages

    • Ensure high RNA quality (minimum RIN score of 8)

    • Use 1.5-2 μg of RNA for slot-blot hybridization or 20 μg for Northern blot when analyzing mt-nd3

  • Probe Selection and Preparation:

    • Use specific 32P-labelled DNA probes complementary to the mt-nd3 region

    • Ensure high specific activity of the probe (>108 cpm/μg)

    • For Northern blots, probes hybridizing with more than one transcript should be carefully designed to distinguish between them

  • Hybridization Conditions:

    • Optimize temperature and salt concentration for maximum specificity

    • Extend hybridization time (12-16 hours) for low-abundance transcripts

    • Use appropriate positive controls (e.g., more abundant mitochondrial transcripts)

  • Detection and Visualization:

    • Allow for longer exposure times when autoradiography is used

    • Consider phosphorimager systems for quantitative analysis and better sensitivity

    • Be aware that the faint signal from mt-nd3 (0.34 kb) may require special attention to avoid over-exposure

How can researchers effectively produce and purify recombinant Xenopus laevis mt-nd3 protein?

Effective production and purification of recombinant Xenopus laevis mt-nd3 protein involves several critical steps:

  • Expression System Selection:

    • Prokaryotic systems (E. coli): Suitable for producing the protein in high yields, though proper folding may be challenging for membrane proteins

    • Eukaryotic systems (insect cells, yeast): Better for maintaining native protein conformation and post-translational modifications

  • Vector Design Considerations:

    • Include appropriate fusion tags (His, GST, or MBP) to facilitate purification

    • Optimize codon usage for the expression system

    • Consider a cleavable tag system to obtain native protein after purification

  • Expression Optimization:

    • Test multiple induction conditions (temperature, inducer concentration, duration)

    • For membrane proteins like mt-nd3, lower expression temperatures (16-20°C) often improve folding

    • Consider co-expression with chaperones to enhance proper folding

  • Purification Strategy:

    • Use appropriate detergents for membrane protein solubilization

    • Implement a multi-step purification process:
      a) Affinity chromatography (based on fusion tag)
      b) Size exclusion chromatography
      c) Ion exchange chromatography if needed

    • Validate protein identity using mass spectrometry and Western blotting

  • Quality Control:

    • Assess protein purity by SDS-PAGE

    • Verify functional activity through appropriate enzymatic assays

    • Evaluate protein stability under various storage conditions

What approaches are most effective for studying mt-nd3 mutations and their impact on mitochondrial function?

To effectively study mt-nd3 mutations and their functional consequences, researchers can employ several complementary approaches:

  • Genetic Analysis:

    • Next-generation sequencing (NGS) for identifying mutations and quantifying heteroplasmy levels

    • PCR-RFLP (Restriction Fragment Length Polymorphism) for targeting known mutations

    • Digital droplet PCR for precise quantification of mutation load

  • Functional Assessment:

    • Oxygen consumption measurements to evaluate respiratory chain function

    • Complex I enzyme activity assays using spectrophotometric methods

    • ATP production assays to assess the impact on energy metabolism

    • Membrane potential analysis using fluorescent dyes (e.g., TMRM, JC-1)

  • Cellular and Biochemical Studies:

    • Generation of cell models carrying specific mt-nd3 mutations

    • Blue Native PAGE for analyzing complex I assembly and stability

    • Reactive oxygen species (ROS) measurement using fluorescent probes

    • Mitochondrial morphology assessment using electron microscopy or fluorescence imaging

  • In vivo Modeling:

    • Development of transgenic Xenopus models with specific mt-nd3 mutations

    • Phenotypic characterization focusing on tissues with high energy demands

    • Correlation analysis between mutation load and phenotypic severity

For clinical relevance, researchers studying mt-nd3 mutations often investigate correlations between mutation characteristics (such as heteroplasmy level) and disease manifestations, as demonstrated in studies of MT-ND3 mutations in human Leigh syndrome .

What are the current gaps in understanding the tissue-specific effects of mt-nd3 mutations in Xenopus models?

Current research presents several knowledge gaps regarding tissue-specific effects of mt-nd3 mutations in Xenopus models:

  • Tissue Heteroplasmy Variation: Limited data exists on how mt-nd3 mutation loads vary across different tissues during Xenopus development and how this correlates with tissue-specific dysfunction.

  • Threshold Effects: The minimum mutation load required to produce biochemical defects in different Xenopus tissues remains poorly characterized, unlike in human studies where some correlation data exists .

  • Compensatory Mechanisms: How different tissues compensate for mt-nd3 dysfunction through metabolic reprogramming or mitochondrial dynamics remains largely unexplored in Xenopus models.

  • Developmental Timing: While general patterns of mitochondrial gene expression during Xenopus development have been documented , specific information about how mt-nd3 mutations affect different developmental stages requires further investigation.

Future research should aim to establish transgenic Xenopus models with controlled mt-nd3 mutations to systematically address these knowledge gaps.

How can integration of -omics approaches advance our understanding of mt-nd3 function and dysfunction?

Integration of multiple -omics approaches offers powerful opportunities to advance understanding of mt-nd3 function:

  • Multi-omics Integration Framework:

    • Genomics: Identify mutations and variation in mt-nd3 across populations

    • Transcriptomics: Map expression changes in response to mt-nd3 dysfunction

    • Proteomics: Characterize changes in the mitochondrial proteome and complex I composition

    • Metabolomics: Identify metabolic signatures of mt-nd3 dysfunction

  • Systems Biology Applications:

    • Pathway analysis to understand compensatory mechanisms

    • Network modeling to identify key nodes affected by mt-nd3 dysfunction

    • Machine learning approaches to predict phenotypic outcomes based on molecular signatures

  • Single-cell Applications:

    • Single-cell transcriptomics to capture cellular heterogeneity in response to mt-nd3 mutations

    • Spatial transcriptomics to map tissue-specific effects during development

    • Combined single-cell multi-omics for comprehensive understanding of cellular consequences

This integrated approach would provide a more comprehensive understanding of how mt-nd3 dysfunction affects the entire cellular system, beyond just mitochondrial function.

What is the evolutionary significance of mt-nd3 conservation and variation across species?

The evolutionary aspects of mt-nd3 present important research questions:

  • Functional Conservation: Understanding which regions of mt-nd3 are most conserved across species from Xenopus to humans can identify functionally critical domains.

  • Species-Specific Adaptations: Exploring variations in mt-nd3 sequence and regulation across species adapted to different environments may reveal evolutionary strategies for optimizing mitochondrial function.

  • Selection Pressures: Analyzing the evolutionary rate of mt-nd3 compared to other mitochondrial genes can provide insights into the selective pressures acting on different components of the respiratory chain.

  • Co-evolution: Investigating how mt-nd3 has co-evolved with nuclear-encoded complex I subunits can enhance our understanding of mitonuclear communication and compatibility.

By comparing the patterns of mitochondrial gene expression during development across species, such as the differences observed between Xenopus and mouse embryos , researchers can gain insights into both conserved and divergent aspects of mitochondrial regulation during evolution.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.