Recombinant Xenopus laevis Nuclear envelope phosphatase-regulatory subunit 1 (cnep1r1)

Shipped with Ice Packs
In Stock
Cat. No.
BT2434693
Source
in vitro E.coli expression system
Synonyms
cnep1r1; tmem188; Nuclear envelope phosphatase-regulatory subunit 1; Transmembrane protein 188
Quick Inquiry

Description

Introduction to Recombinant Xenopus laevis Nuclear Envelope Phosphatase-Regulatory Subunit 1 (CNEP1R1)

Recombinant Xenopus laevis Nuclear Envelope Phosphatase-Regulatory Subunit 1 (CNEP1R1) is a protein derived from the African clawed frog, Xenopus laevis. This protein is involved in the regulation of nuclear envelope phosphatase activity, which plays a crucial role in maintaining cellular structure and function. While specific research on the recombinant form of CNEP1R1 from Xenopus laevis is limited, understanding its human counterpart and related biological processes can provide valuable insights.

Function of CNEP1R1

CNEP1R1 is known to form a complex with the serine/threonine protein phosphatase CTDNEP1. This complex is essential for dephosphorylating and activating lipins, which are crucial for lipid metabolism and maintaining endoplasmic reticulum (ER) membrane morphology . In humans, CNEP1R1 is located on chromosome 16 and is part of the CTDNEP1-NEP1R1 membrane protein phosphatase complex .

Xenopus laevis as a Model Organism

Xenopus laevis is widely used as a model organism in developmental biology and genetic studies due to its ease of manipulation and similarity to human developmental processes . While specific studies on recombinant CNEP1R1 from Xenopus laevis are scarce, the organism's utility in studying cellular and molecular mechanisms makes it a valuable tool for understanding related proteins and pathways.

Research Findings and Potential Applications

Given the lack of direct research on recombinant Xenopus laevis CNEP1R1, we can infer potential applications based on its role in cellular processes. The study of CNEP1R1 and related phosphatases could provide insights into lipid metabolism and ER function, which are critical in various cellular contexts.

Table: Overview of CNEP1R1 Function and Related Proteins

Protein/ComplexFunctionOrganism
CNEP1R1 (Human)Regulatory subunit of CTDNEP1 phosphatase, involved in lipid metabolism and ER morphology maintenanceHuman
CTDNEP1-NEP1R1 ComplexDephosphorylates and activates lipinsHuman
M18BP1 (Xenopus)Involved in centromeric chromatin assemblyXenopus laevis

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
cnep1r1; tmem188; Nuclear envelope phosphatase-regulatory subunit 1; Transmembrane protein 188
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-125
Protein Length
full length protein
Species
Xenopus laevis (African clawed frog)
Target Names
cnep1r1
Target Protein Sequence
MNSLEQAEDLKAFERRLTEYVSCLQPTTGRWRMLLIVVSVCTATGAWNWLIDPETQKVSF FTSLWNHPFFTISCITLIGLFFAGIHKRVVAPSIIAARCRTVLAEYNMSCDDTGKLILKP RPHVQ
Uniprot No.
Q7ZY85

Target Background

Function
This protein may form an active complex with the serine/threonine protein phosphatase ctdnep1, dephosphorylating and activating lipins. Lipins are phosphatidate phosphatases that catalyze the conversion of phosphatidic acid to diacylglycerol, thereby regulating fatty acid metabolism. This protein may indirectly modulate the lipid composition of nuclear and/or endoplasmic reticulum membranes and be essential for proper nuclear membrane morphology and dynamics. It may also indirectly regulate lipid droplet production and triacylglycerol levels.
Database Links

KEGG: xla:380569

UniGene: Xl.21986

Protein Families
CNEP1R1 family
Subcellular Location
Nucleus membrane; Multi-pass membrane protein. Cytoplasm.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *

Category

Service

THE BIOTEK
THE BioTek is a global biotech company offering highly purified proteins for research in cancer, apoptosis, development, endocrinology, immunology, neuroscience, proteases, and stem cells.
  • Contact
  • Address: 1925 E Maple Ave, El Segundo, CA 90245 United States
  • Phone : +1 201-285-7826
  • Email : info@thebiotek.com
  • Hours : Mon.-Fri. 9:00 AM - 5:00 PM
© Copyright 2025 TheBiotek. All Rights Reserved.