Recombinant Xenopus laevis Nucleolar complex protein 4 homolog A (noc4l-a)

Shipped with Ice Packs
In Stock

Description

Overview

Recombinant Xenopus laevis Nucleolar complex protein 4 homolog A (noc4l-a) is a protein expressed in E. coli and tagged with N-terminal His for purification and identification purposes . It is a homolog of the human PNAS-4 protein, which has pro-apoptotic functions .

Table 1: Key Features of Recombinant Xenopus laevis Noc4l-a Protein

FeatureDescription
SpeciesXenopus laevis
SourceE. coli
TagHis
Protein LengthFull Length (1-526 amino acids)
FormLyophilized powder
PurityGreater than 90% as determined by SDS-PAGE
Synonymsnoc4l-a; Nucleolar complex protein 4 homolog A; NOC4 protein homolog A; NOC4-like protein A; Nucleolar complex-associated protein 4-like protein A
UniProt IDQ6NRQ2
Amino Acid SequenceMAARKTKHACRIQDKRSDAERQDLDTKLAAVLESRGNANAVFDILEHLESKKEEVVQAAIRTASKLFEVMLEKRELYIGDLPAENGTLPDTYSAEDKYKMWMRHRYNSCAACILDLLQHSSFSNQELALCTLMKFIQLEGKFPLENSEWKDSYRFPRELLKFVIDNLLQEEADCTLLITRFQEYLEYDDVRYYTMTVTNDCVSRVQQKNKLVLPPVFQTNVFCLLSSINIPVEESALGNFLVTKNVNNEDWKPSKLKDHKRVFERVWMIFLKHQLSVSLYKKVLLILHESILPHMSKPTLMIDFLTAAYDVGGAISLLALNGLFILIHQHNLEYPDFYKKLYSLLEPSIFHVKYRARFFHLANMFLSSTHLPVYLVAAFAKRLARLALTAPPQVLLMIIPFICNLIRRHPACRVLIHRPSAGDLATDPYIMEEQDPAKSQALESSLWELEVLQQHYHGDVVRAANVISRPLSAQESDISGLLEISSCELYDKEMKKKKFKSVPLEYEPVRGLLGLKSDITAQHFTF

Production and Purification

Recombinant noc4l-a protein is produced in E. coli cells, which are then lysed to extract the protein . Due to the protein's tendency to form insoluble inclusion bodies, it is purified using methods that involve denaturing and refolding . A typical procedure includes:

  1. Dissolving inclusion bodies in a denaturing buffer containing 8 M urea .

  2. Purifying the protein using Ni2+ affinity chromatography, taking advantage of the His tag .

  3. Refolding the denatured protein through stepwise dialysis to reduce the urea concentration gradually .

This process yields a purified protein with a purity of approximately 95% .

Role in Apoptosis

The Xenopus laevis homolog of PNAS-4 (xPNAS-4) is involved in apoptosis, a programmed cell death process crucial for development and tissue homeostasis . Recombinant xPNAS-4 can be used to generate antibodies for detecting PNAS-4 expression in Xenopus laevis embryos, making it a valuable tool for studying apoptotic mechanisms .

Genetic Code Expansion Studies

In Xenopus laevis embryos, researchers have utilized the pyrrolysyl-tRNA synthetase/tRNA (PylRS/PylT) system to incorporate unnatural amino acids (UAAs) into proteins, expanding the genetic code . These studies have shown that injecting PylRS mRNA, a reporter mRNA (Rluc), and PylT into fertilized embryos allows for the successful incorporation of UAAs into expressed proteins . This approach enables the introduction of new chemical functionalities into proteins, facilitating the study of protein function and creating proteins with novel properties .

NO145: A Nucleolar Cortex Protein

Another nucleolar protein, NO145, has been characterized in Xenopus laevis oocytes . NO145 is a component of the nucleolar cortex, a karyoskeletal structure that surrounds the nucleolus . This protein contributes to the shape and internal architecture of the nucleolus, forming a cage-like structure dependent on divalent cations .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in your order notes for fulfillment according to your requirements.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and arranged in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag type, please inform us; we will prioritize its development.
Synonyms
noc4l-a; Nucleolar complex protein 4 homolog A; NOC4 protein homolog A; NOC4-like protein A; Nucleolar complex-associated protein 4-like protein A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-526
Protein Length
full length protein
Species
Xenopus laevis (African clawed frog)
Target Names
noc4l-a
Target Protein Sequence
MAARKTKHACRIQDKRSDAERQDLDTKLAAVLESRGNANAVFDILEHLESKKEEVVQAAI RTASKLFEVMLEKRELYIGDLPAENGTLPDTYSAEDKYKMWMRHRYNSCAACILDLLQHS SFSNQELALCTLMKFIQLEGKFPLENSEWKDSYRFPRELLKFVIDNLLQEEADCTLLITR FQEYLEYDDVRYYTMTVTNDCVSRVQQKNKLVLPPVFQTNVFCLLSSINIPVEESALGNF LVTKNVNNEDWKPSKLKDHKRVFERVWMIFLKHQLSVSLYKKVLLILHESILPHMSKPTL MIDFLTAAYDVGGAISLLALNGLFILIHQHNLEYPDFYKKLYSLLEPSIFHVKYRARFFH LANMFLSSTHLPVYLVAAFAKRLARLALTAPPQVLLMIIPFICNLIRRHPACRVLIHRPS AGDLATDPYIMEEQDPAKSQALESSLWELEVLQQHYHGDVVRAANVISRPLSAQESDISG LLEISSCELYDKEMKKKKFKSVPLEYEPVRGLLGLKSDITAQHFTF
Uniprot No.

Target Background

Database Links

KEGG: xla:431875

UniGene: Xl.33955

Protein Families
CBF/MAK21 family
Subcellular Location
Nucleus membrane; Multi-pass membrane protein. Nucleus, nucleolus.

Q&A

What is the basic structure of Xenopus laevis NOC4L-A protein and how does it compare to homologs in other species?

NOC4L-A in Xenopus laevis is a 526-amino acid protein containing a highly conserved Noc domain (approximately residues 416-460) at its C-terminus . This domain is a 45-amino acid stretch that is evolutionarily conserved across multiple species. Phylogenetic analysis indicates that NOC4L is present in many eukaryotic organisms with varying degrees of homology:

SpeciesProtein LengthHomology to Human NOC4L
Xenopus laevis NOC4L-A526 amino acids~79%
Mouse NOC4L516 amino acids~79.1%
Human NOC4L516 amino acids100%
Yeast Noc4pVariable~36.1%

The protein contains no predicted nuclear localization signal (NLS), which differs from its yeast counterpart Noc4p, suggesting potential differences in subcellular localization and function .

What is the primary function of NOC4L-A in Xenopus laevis?

  • Embryonic development: NOC4L is essential for early embryonic development, with knockout studies showing embryonic lethality at the morula stage .

  • Ribosomal processing: Similar to yeast Noc4p, NOC4L-A likely participates in 18S rRNA processing .

  • Potential extraribosomal functions: Due to its cytoplasmic localization (unlike the nucleolar localization of yeast Noc4p), NOC4L-A may have additional functions beyond ribosome biogenesis .

The protein shows dynamic expression during embryonic development, with peak expression observed in oocytes, one-cell embryos, and morula-stage embryos, suggesting stage-specific roles during early development .

What is the tissue-specific expression pattern of NOC4L in Xenopus laevis and how does it compare to mammalian systems?

NOC4L is ubiquitously expressed across Xenopus laevis tissues, but with notable variation in expression levels:

  • High expression: Testes, lymphoid organs (spleen, thymus, lymph nodes)

  • Moderate expression: Adipose tissue (both epididymal white adipose and brown adipose)

  • Variable expression: Heart, brain, liver, lung, kidney, small intestine, colon, and muscle

This expression pattern is similar to mammals, where NOC4L is also highly expressed in immune organs, testis, and adipose tissue. In humans, RNA-seq data from public databases indicate high expression in testis, fat, and immune organs .

During embryonic development, NOC4L shows a dynamic expression pattern:

  • Strong expression in oocytes and one-cell embryos

  • Decreased expression at the 2-cell stage

  • Increased expression at the morula stage

  • Protein first detected at the 8-cell stage and consistently observed through morula and blastocyst stages

What is the subcellular localization of NOC4L-A in Xenopus laevis cells, and how can researchers effectively visualize this localization?

Unlike its yeast counterpart Noc4p, which localizes to the nucleolus, NOC4L-A in Xenopus laevis primarily localizes to the cytoplasm, particularly in perinuclear membrane granule-like organelles . This localization pattern has been confirmed through multiple experimental approaches:

  • EGFP fusion proteins: Both N-terminal (EGFP-NOC4L) and C-terminal (NOC4L-EGFP) fusion proteins predominantly localize to cytoplasmic granules when expressed in cells .

  • FLAG-tagged recombinant proteins: Both N-terminal (Flag-NOC4L) and C-terminal (NOC4L-Flag) constructs show similar cytoplasmic granular localization patterns .

  • Direct immunofluorescence: Using antibodies against NOC4L confirms the cytoplasmic localization pattern .

To effectively visualize NOC4L-A localization, researchers should:

  • Use either fluorescent protein fusions or epitope tags (FLAG, His, etc.)

  • Include appropriate controls for non-specific localization

  • Consider co-localization studies with markers for specific cytoplasmic organelles

  • Utilize confocal microscopy for optimal resolution of granular structures

The cytoplasmic localization suggests that NOC4L may have extraribosomal functions beyond its role in 40S ribosomal subunit biogenesis, as many nucleolar proteins have dual functions and can localize to different cellular compartments .

What are the optimal conditions for recombinant expression and purification of NOC4L-A from Xenopus laevis?

Based on successful protocols for similar Xenopus proteins and NOC4L-specific information, the recommended procedure for recombinant NOC4L-A expression and purification is:

Expression System and Conditions:

  • Host: E. coli (BL21 strain preferred)

  • Expression vector: pET series with N-terminal His tag

  • Induction: 0.5-1.0 mM IPTG at OD600 = 0.6-0.8

  • Temperature: 16-18°C for 16-20 hours (to enhance solubility)

  • Medium: LB with appropriate antibiotics

Purification Strategy:

  • Cell lysis: Sonication in buffer containing 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10 mM imidazole, 1 mM DTT, and protease inhibitors

  • Initial purification: Ni-NTA affinity chromatography

  • Protein refolding: If expressed as inclusion bodies, solubilize in 8 M urea and refold by stepwise dialysis to gradually reduce urea concentration

  • Secondary purification: Size exclusion chromatography

  • Storage: In Tris-based buffer with 50% glycerol at -80°C

Typical Yield and Purity:

  • Expected yield: 3-5 mg purified protein per liter of culture

  • Purity: >90% as determined by SDS-PAGE

Quality Control:

  • Confirm identity by mass spectrometry (LC-ESI-Q-TOF-MS recommended)

  • Verify activity through binding assays with known interaction partners

What are the methodological challenges in working with recombinant NOC4L-A and how can they be overcome?

Researchers face several challenges when working with recombinant NOC4L-A:

  • Protein solubility issues: NOC4L-A often forms inclusion bodies when expressed in E. coli.

    • Solution: Express at lower temperatures (16-18°C) and lower IPTG concentrations (0.1-0.5 mM), or use solubility enhancing fusion tags like MBP or SUMO.

  • Protein stability concerns: The protein may be prone to degradation during purification.

    • Solution: Include protease inhibitors at all stages, keep samples at 4°C, and minimize freeze-thaw cycles.

  • Functional verification: Confirming that the recombinant protein retains native activity can be challenging.

    • Solution: Develop binding assays with known interaction partners (e.g., TLR4 for mammalian homologs) , or use ribosome assembly assays.

  • Structural integrity: Ensuring proper folding is crucial for functional studies.

    • Solution: Use circular dichroism (CD) spectroscopy to verify secondary structure elements and thermal shift assays to assess stability.

  • Species-specific differences: Function may vary between Xenopus and mammalian homologs.

    • Solution: Always include appropriate controls and validate findings across multiple experimental systems.

For antibody production against NOC4L-A, the preferred approach is to immunize rabbits with the purified recombinant protein, followed by affinity purification of the resulting antibodies . These antibodies can then be validated for specificity using Western blotting against Xenopus tissue lysates.

How does NOC4L-A contribute to early embryonic development in Xenopus laevis, and what are the phenotypic consequences of its deletion?

NOC4L-A plays a critical role in early embryonic development in Xenopus laevis. Studies show its expression is tightly regulated during embryogenesis, with highest mRNA levels in oocytes, one-cell embryos, and at the morula stage. The protein is first detected at the 8-cell stage and remains present through the morula and blastocyst stages .

The phenotypic consequences of NOC4L deletion are severe:

  • Complete embryonic lethality: Homozygous knockout (Noc4l-/-) is 100% lethal during preimplantation development .

  • Developmental arrest at morula stage: Noc4l-/- embryos develop normally until the 8-16 cell stage but fail to progress beyond the morula stage to form blastocysts .

  • Specific cellular defects in knockout embryos:

    • Increased apoptosis (detected by cleaved caspase-3 immunostaining)

    • Chromatin fragmentation (visualized by DAPI staining)

    • Significantly decreased cell number in morulae

    • Embryonic degeneration by E4.5, with cells detaching from the zona pellucida

Interestingly, heterozygous (Noc4l+/-) mice are viable, fertile, and show no apparent abnormalities, suggesting that half the normal NOC4L dosage is sufficient for development and adult function .

What experimental approaches are most effective for studying NOC4L-A function during Xenopus laevis embryogenesis?

Several complementary approaches have proven effective for studying NOC4L-A function during Xenopus embryogenesis:

  • Targeted microinjection: Xenopus embryos are particularly well-suited for targeted injection of antisense morpholino oligonucleotides (for knockdown) or synthetic mRNAs (for overexpression) .

    • Methodology: Inject morpholinos or mRNAs into specific blastomeres up to the 32-cell stage

    • Advantage: Allows tissue-specific manipulation of gene expression

  • CRISPR/Cas9-mediated editing: For permanent genetic modifications.

    • Methodology: Inject Cas9 protein and guide RNAs targeting noc4l-a into fertilized eggs

    • Advantage: Creates stable genetic modifications

  • In vitro culture of embryos: For extended observation of developmental phenotypes.

    • Methodology: Culture embryos in simple salt solutions with appropriate supplements

    • Advantage: Allows real-time monitoring of developmental progression

  • Immunofluorescence and in situ hybridization: For spatial and temporal expression analysis.

    • Methodology: Use NOC4L-specific antibodies or RNA probes on fixed embryos

    • Advantage: Provides detailed expression patterns during development

  • Ex vivo biochemical assays: For mechanistic studies.

    • Methodology: Use Xenopus egg extracts to study ribosome assembly and other processes

    • Advantage: Provides a biochemically tractable system that maintains many in vivo properties

For phenotypic analysis, researchers should employ:

  • Careful staging of embryos according to established Xenopus developmental stages

  • Appropriate molecular markers for specific cell types or developmental processes

  • Time-lapse imaging for dynamic processes

  • Quantitative measurements of cell number, apoptosis rates, and proliferation markers

How does NOC4L function in immune cells, and what evidence suggests its role in inflammation regulation?

Although most studies on immune function used mammalian NOC4L rather than Xenopus NOC4L-A specifically, the high conservation (79% homology) suggests similar functions. The evidence indicates:

  • Preferential expression in immune cells: NOC4L is highly expressed in human and mouse macrophages and lymphoid organs .

  • Regulation of TLR4 signaling: In macrophages, NOC4L interacts directly with TLR4 to inhibit its endocytosis, thereby blocking the TRIF-dependent signaling pathway . This mechanism suggests NOC4L acts as a negative regulator of certain inflammatory responses.

  • Impact on inflammatory cytokine production: Macrophage-specific deletion of Noc4l in mice results in:

    • Significantly increased expression of pro-inflammatory cytokines (IL-6, TNFα)

    • Decreased expression of anti-inflammatory markers (IL-10, Arg1, Mrc1)

    • Enhanced M1-like macrophage polarization

  • Critical role in regulatory T cells: Noc4l is highly expressed in activated regulatory T cells (Tregs) and controls their activation . Conditional knockout of Noc4l in Tregs leads to:

    • Lethal autoimmune phenotype similar to Treg-deficient "scurfy" mice

    • Selective impairment of genes related to Treg activation

  • Connection to metabolic disease: NOC4L levels are decreased in obese humans and mice, and macrophage-specific Noc4l deletion aggravates high-fat diet-induced inflammation and insulin resistance .

Can Xenopus laevis NOC4L-A be used as a model to study immune-related diseases, and what experimental systems would be most appropriate?

Xenopus laevis and its NOC4L-A protein offer unique advantages for studying immune-related diseases:

  • Evolutionary perspective: As amphibians, Xenopus occupy an intermediate phylogenetic position between aquatic vertebrates and land tetrapods, allowing comparative studies across vertebrate evolution .

  • Conservation of immune components: Xenopus has an immune system fundamentally similar to mammals, including:

    • Thymus and spleen as primary lymphoid organs

    • T and B cells with RAG-mediated receptor diversity

    • Conserved innate immune mechanisms

  • Experimental tractability: Xenopus offers several advantages:

    • Large embryo size facilitating microinjection and manipulation

    • External development allowing easy observation

    • Well-established genetic tools including transgenesis and CRISPR/Cas9

Recommended experimental systems include:

  • In vivo models:

    • Transgenic Xenopus with fluorescent immune cell lineages

    • CRISPR/Cas9-generated NOC4L-A mutants

    • Conditional expression systems for temporal control

  • Ex vivo approaches:

    • Primary macrophage cultures from Xenopus

    • Spleen and thymus explant cultures

    • Xenopus egg extracts for biochemical studies

  • Specific disease models:

    • Inflammation models using TLR ligands or pathogens

    • Autoimmune models through appropriate antigenic stimulation

    • Metabolic disease models via diet manipulation

For translating findings from Xenopus to human disease, researchers should:

  • Identify conserved molecular interactions and pathways

  • Validate key findings in mammalian systems

  • Focus on fundamental mechanisms rather than species-specific responses

How does NOC4L-A function differ between its roles in ribosome biogenesis and extra-ribosomal activities?

NOC4L-A demonstrates a fascinating dual functionality that appears to be mechanistically distinct:

  • Ribosomal functions:

    • In yeast, Noc4p forms a complex with Nop14p to mediate 40S ribosomal subunit maturation and nuclear export .

    • In Xenopus and mammals, NOC4L likely contributes to 18S rRNA processing, though the exact mechanism may differ .

    • Noc4L deficient T cells have a smaller 40S peak, affecting selective protein translation in regulatory and conventional T cells .

  • Extra-ribosomal functions:

    • Direct interaction with TLR4 to inhibit endocytosis and block TRIF-dependent signaling .

    • Potential interaction with SIRT1 leading to inhibition of SIRT1-mediated deacetylation of p53, thus promoting apoptosis in cancer cells .

    • Association with pre-40S ribosome complexes increases during Kaposi's sarcoma-associated herpesvirus (KSHV) lytic replication .

The functional separation is reflected in subcellular localization patterns:

  • Yeast Noc4p is predominantly nucleolar, consistent with its dedicated role in ribosome biogenesis .

  • Xenopus NOC4L-A and mammalian NOC4L show both faint nuclear and strong cytoplasmic localization, particularly in perinuclear granule-like structures .

This bifunctionality presents an intriguing question of how a single protein evolved distinct roles in fundamental cellular processes, and whether these functions are mechanistically linked or completely independent.

How can contradictory findings about NOC4L function across different studies be reconciled?

Several apparent contradictions in NOC4L research can be identified:

  • Subcellular localization discrepancy:

    • Yeast Noc4p is primarily nucleolar

    • Xenopus and mammalian NOC4L show predominant cytoplasmic localization

    • Reconciliation: The lack of predicted nuclear localization signals (NLS) in NOC4L suggests it may enter nuclei through interaction with NLS-containing binding partners . Different experimental conditions might favor different binding partners, explaining localization differences.

  • Developmental vs. immune functions:

    • Complete knockout causes preimplantation embryonic lethality

    • Conditional knockout in specific immune cells causes more selective phenotypes

    • Reconciliation: NOC4L may have cell type-specific functions; its role in early development likely relates to fundamental processes like ribosome biogenesis, while its immune functions may involve more specialized regulatory pathways.

  • Pro-survival vs. pro-apoptotic effects:

    • NOC4L deletion causes apoptosis in early embryos

    • NOC4L overexpression promotes apoptosis in cancer contexts by affecting p53 acetylation

    • Reconciliation: The effect may depend on cellular context and stress conditions. In normal development, NOC4L supports survival by ensuring proper ribosome biogenesis, while under certain stress conditions or in cancer cells, it may promote p53-mediated apoptosis through SIRT1 inhibition.

  • Tissue-specific expression patterns:

    • Some studies report broad expression

    • Others report more restricted patterns in immune and proliferative tissues

    • Reconciliation: Expression levels vary significantly between tissues, with highest expression in highly proliferative and immune tissues. Detection sensitivity differences across studies could explain apparent discrepancies.

To resolve these contradictions, researchers should:

  • Carefully control experimental conditions

  • Use multiple complementary techniques to validate findings

  • Consider context-specific factors that might influence results

  • Directly compare multiple systems using identical methodologies

How does Xenopus laevis NOC4L-A compare functionally to NOC4L-B and to mammalian NOC4L homologs?

Xenopus laevis, as an allotetraploid species, possesses two NOC4L homologs: NOC4L-A and NOC4L-B. Comparative analysis reveals important similarities and differences:

Structural Comparison:

FeatureNOC4L-ANOC4L-BMammalian NOC4L
Amino Acid Length526 aa525 aa516 aa (human)
Noc DomainPresent (residues ~416-460)Present (similar position)Present (similar position)
Sequence Homology to Human~79%~78%100%

Sequence Comparison:
While the full sequences are too long to display here, key differences exist primarily in the N-terminal regions, while the C-terminal Noc domain shows higher conservation .

Functional Differences:

While these specialized functions haven't been explicitly demonstrated for Xenopus NOC4L-A or B, the high sequence conservation suggests similar roles may exist.

What are the most significant differences between NOC4L function in Xenopus laevis compared to other model organisms?

While NOC4L is highly conserved across species, several notable differences exist between Xenopus and other model organisms:

  • Compared to yeast Noc4p:

    • Subcellular localization: Yeast Noc4p is predominantly nucleolar, while Xenopus NOC4L-A is primarily cytoplasmic

    • Protein interactions: Yeast Noc4p forms a stable heterodimer with Nop14p; similar interactions in Xenopus are likely but not fully characterized

    • Phenotypic effects: Yeast temperature-sensitive mutants show growth defects at 37°C, while Xenopus knockouts show embryonic lethality

  • Compared to mice:

    • Developmental timing: NOC4L knockout in mice causes arrest at the morula-to-blastocyst transition, reflecting the timing of early embryonic development in mammals

    • Immune functions: Mouse studies have revealed specific roles in macrophage polarization and Treg activation that remain to be confirmed in Xenopus

  • Compared to human cells:

    • Cancer relevance: Human NOC4L has been implicated in tumor suppression via p53 regulation; this function has not been extensively studied in Xenopus

    • Virus interactions: Human NOC4L shows increased association with pre-40S complexes during viral infections (e.g., KSHV); Xenopus viral interactions are less characterized

  • Xenopus-specific advantages:

    • The large oocyte and embryo size in Xenopus provides unique opportunities for microinjection and imaging studies

    • The external fertilization and development allow easy manipulation and observation

    • The well-characterized developmental stages facilitate precise temporal studies

For researchers choosing between model systems, Xenopus offers particular advantages for:

  • Developmental studies during early embryogenesis

  • Cell-free biochemical systems (egg extracts)

  • Evolutionary comparative analyses

  • Visualization of subcellular processes

What are the most promising future research directions for Xenopus laevis NOC4L-A in fundamental and translational research?

Several high-potential research directions for NOC4L-A in Xenopus laevis include:

  • Ribosome specialization research:

    • Investigate whether NOC4L-A contributes to the generation of "specialized ribosomes" that preferentially translate specific mRNAs

    • Determine if the NOC4L-A and B paralogs in Xenopus have diverged to regulate different subsets of mRNAs

    • Compare ribosome composition and function between tissues with different NOC4L-A expression levels

  • Developmental regulation mechanisms:

    • Identify the precise molecular mechanism by which NOC4L-A supports morula-to-blastocyst transition

    • Develop conditional knockout systems to study stage-specific functions during later development

    • Investigate potential roles in metamorphosis, which represents a unique developmental transition in amphibians

  • Immune function exploration:

    • Determine if the TLR4-regulatory function observed in mammalian NOC4L is conserved in Xenopus

    • Explore the role of NOC4L-A in amphibian-specific immune responses, such as those against amphibian-specific pathogens

    • Investigate how NOC4L-A expression changes during immune challenges

  • Translational applications:

    • Develop NOC4L-A-based screening systems for compounds that modulate inflammation

    • Explore the conservation of NOC4L-related pathways in human metabolic and autoimmune diseases

    • Investigate NOC4L as a potential therapeutic target for diseases associated with dysregulated inflammation

  • Structural biology approaches:

    • Determine the crystal structure of NOC4L-A to understand its molecular mechanism

    • Compare structures across species to identify conserved functional domains

    • Investigate the structural basis for interactions with binding partners like TLR4

What methodological innovations are needed to advance our understanding of NOC4L-A in Xenopus laevis?

Several methodological advances would significantly benefit NOC4L-A research in Xenopus laevis:

  • Improved genetic tools:

    • Development of more efficient CRISPR/Cas9 methods specific for the allotetraploid Xenopus laevis genome

    • Creation of conditional and inducible knockout/knockin systems for temporal and tissue-specific control

    • Generation of reporter lines that allow real-time visualization of NOC4L-A expression and localization

  • Advanced imaging techniques:

    • Application of super-resolution microscopy to better visualize NOC4L-A's subcellular localization

    • Development of FRET-based biosensors to monitor NOC4L-A interactions in real-time

    • Implementation of light-sheet microscopy for whole-embryo imaging with cellular resolution

  • Biochemical and structural approaches:

    • Improved methods for isolation of native NOC4L-A complexes from Xenopus tissues

    • Development of in vitro reconstitution systems for NOC4L-dependent processes

    • Cryo-EM studies of NOC4L-A in complex with its binding partners

  • Systems biology integration:

    • Comprehensive proteomics to identify the complete interactome of NOC4L-A

    • Ribosome profiling to determine how NOC4L-A affects translation at a genome-wide level

    • Integration of multi-omics data (transcriptomics, proteomics, metabolomics) to build comprehensive models of NOC4L-A function

  • Translational approaches:

    • Development of high-throughput screening methods using Xenopus egg extracts to identify modulators of NOC4L-A function

    • Creation of humanized Xenopus models expressing human NOC4L variants associated with disease

    • Establishment of Xenopus disease models relevant to NOC4L dysfunction

By combining these methodological innovations with the unique advantages of the Xenopus model system, researchers can gain unprecedented insights into the multifaceted functions of NOC4L-A and its relevance to human health and disease.

What are the most reliable sources for obtaining recombinant Xenopus laevis NOC4L-A for research purposes?

Researchers have several options for obtaining high-quality recombinant Xenopus laevis NOC4L-A:

  • Commercial sources:

    • Creative Biomart offers recombinant full-length Xenopus laevis NOC4L-A protein (Q6NRQ2) with His tag expressed in E. coli

    • KXT Biosciences provides ELISA-validated recombinant NOC4L proteins suitable for immunological applications

  • Academic repositories:

    • The Xenopus laevis Research Resource for Immunobiology at the University of Rochester maintains various research tools including molecular probes and DNA libraries that may include NOC4L constructs

    • AddGene and other plasmid repositories may contain expression constructs for NOC4L-A submitted by researchers

  • In-house production:

    • For researchers requiring custom modifications or large quantities, expressing the protein in-house using E. coli expression systems is recommended

    • The full amino acid sequence is available (see table below) for designing expression constructs

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.