Noc4l-b belongs to the nucleolar complex protein family, homologous to yeast Noc4p, which facilitates 40S ribosomal subunit assembly. In Xenopus laevis, it is localized to the nuclear envelope and nuclear membrane, playing roles in ribosome biogenesis and nuclear organization . Key structural features include:
Sequence: MAARKAKHAFRSQATQSDAERQDLDSKLAAVLESRGNANAVFDILEHLESKKEDVVQAAI RTTSKLFEVLLEKRELYIGDLPAEDDSPPDTCSAEDKYKMWMRNRYNSCVSCLLDLLQYS SFSVQELVLCTLMKFIQLEGKFPLENSEWRDSYRFPRELLKFVVDNLLQEEADCTLLITR FQEYLEYDDVRYYTMTVTTECVSRIQQKNKQVLPPVFQTNVFCLLSSINMPVEESTLGNF LVTKNENHEEWKPSKLKEQKRVFERVWMSFLKHQLSVSLYKKVLLILHESILPHMSKPSL MIDFLTAAYDVGGAISLLALNGLFILIHQHNLEYPDFYKKLYSLLEPSVFHVKYRARFFH LANLFLSSTHLPVYLVAAFAKRLARLALTAPPQVLLMIIPFICNLIRRHPACRVLIHRPS AGDLVTDPYIMEEQDPAKSQALESCLWELEVLQQHYHGDVVRAANVISRALSAQESDVSG LLEMSSCELFDKEMKKKFKSVPLEYEPVRGLLGLKSDITAEHFTF .
Gene Synonyms: noc4l-b, Nucleolar complex protein 4 homolog B, NOC4-like protein B .
The recombinant noc4l-b is produced via bacterial expression systems with a His-tag for purification. Key technical specifications are summarized below:
Avoid repeated freeze-thaw cycles.
Reconstitute with 5-50% glycerol for long-term storage.
Noc4l-b’s roles span ribosome biogenesis, nuclear architecture, and immune regulation. Below are key findings from diverse studies:
Noc4l-b is critical for 40S ribosomal subunit assembly, mirroring yeast Noc4p function . In Xenopus laevis embryos:
Expression: Robust in oocytes, 1-cell embryos, and morula stages. Protein detection peaks at the 8-cell stage, aligning with ribosome biogenesis activation .
Localization: Cytoplasmic granules and nuclear compartments, suggesting a dual role in translation and nucleolar organization .
Noc4l-b localizes to the nuclear envelope and nuclear membrane, contributing to nucleolar organization. In Xenopus oocytes:
Structural Role: Part of a karyoskeletal meshwork stabilizing nucleolar domains .
Topology: Transmembrane domains (predicted via sequence analysis) .
In murine models, Noc4l (the mammalian homolog) modulates macrophage activity:
TLR4/TRIF Pathway Inhibition: Noc4l binds TLR4, blocking its endocytosis and downstream TRIF signaling. This reduces proinflammatory cytokines (e.g., IL-6, TNFα) and improves insulin resistance in obesity models .
Macrophage Polarization: Deletion of Noc4l skews macrophages toward M1 (proinflammatory) over M2 (anti-inflammatory) states .
KEGG: xla:414653
UniGene: Xl.47033
Xenopus laevis has become a model of choice for various biological fields including immunology due to its easily inducible breeding in laboratory settings through human gonadotrophin injection. The evolutionary distance between X. laevis and mammals allows researchers to distinguish species-specific adaptations from conserved features of biological systems, including immune responses . Additionally, X. laevis offers large, abundant eggs and easily manipulated embryos while maintaining conserved cellular, developmental, and genomic organization with mammals, making it ideal for studying conserved proteins like Noc4l-b .
Advantages: X. laevis exhibits an immune system fundamentally similar to mammals, including leukocytes involved in innate immunity and B and T lymphocytes expressing a wide repertoire of somatically generated receptors . This conservation makes it valuable for immunological studies involving Noc4l-b. The system also enables gain-of-function experiments through mRNA injection into embryos .
Limitations: X. laevis has an allotetraploid genome, resulting from the hypothesized hybridization of two species, which yields gene duplicates that often complicate the study of mutant phenotypes . Additionally, X. laevis has a generation time exceeding one year, making genetic studies time-consuming . These limitations have led researchers to sometimes use X. tropicalis as a complementary genetic model while maintaining X. laevis for biochemical and molecular studies of Noc4l-b .
Despite the challenges posed by X. laevis's allotetraploid genome, researchers can employ several strategies to study Noc4l-b function. Dominant negative constructs have been successfully used in X. laevis for manipulation of specific gene functions . For Noc4l-b specifically, researchers should consider using antisense morpholinos targeting conserved regions of both gene duplicates, or CRISPR/Cas9 techniques modified for use in X. laevis. When designing genetic manipulations, researchers should first sequence both Noc4l-b alleles to identify conserved regions for targeting. Verification of knockdown efficiency should be performed using both qRT-PCR and Western blotting with specific anti-Noc4l-b antibodies, such as those described in available literature .
When comparing Noc4l-b function between X. laevis and mammalian systems, researchers must consider several factors. First, the allotetraploid nature of X. laevis means there may be two variants of Noc4l-b with potentially divergent functions . Expression patterns should be carefully analyzed in both systems under comparable conditions. For macrophage studies, researchers should note that while adipose tissue macrophages (ATMs) express NOC4L in mice, the corresponding expression patterns in X. laevis need verification . Experimental designs should include parallel assays in both systems using conserved stimuli (e.g., LPS) and readout parameters. Additionally, temperature differences in experimental conditions must be standardized, as X. laevis is a poikilotherm while mammalian systems function at constant temperatures. Cross-species complementation experiments, where mammalian Noc4l is expressed in X. laevis Noc4l-deficient cells and vice versa, can provide insights into functional conservation.
The Xenopus laevis Nucleolar complex protein 4 homolog B (Noc4l-b) is a full-length protein consisting of 525 amino acids . The complete amino acid sequence is: MAARKAKHAFRSQATQSDAERQDLDSKLAAVLESRGNANAVFDILEHLESKKEDVVQAAIRTTSKLFEVLLEKRELYIGDLPAEDDSPPDTCSAEDKYKMWMRNRYNSCVSCLLDLLQYSSFSVQELVLCTLMKFIQLEGKFPLENSEWRDSYRFPRELLKFVVDNLLQEEADCTLLITRFQEYLEYDDVRYYTMTVTTECVSRIQQKNKQVLPPVFQTNVFCLLSSINMPVEESTLGNFLVTKNENHEEWKPSKLKEQKRVFERVWMSFLKHQLSVSLYKKVLLILHESILPHMSKPSLMIDFLTAAYDVGGAISLLALNGLFILIHQHNLEYPDFYKKLYSLLEPSVFHVKYRARFFHLANLFLSSTHLPVYLVAAFAKRLARLALTAPPQVLLMIIPFICNLIRRHPACRVLIHRPSAGDLVTDPYIMEEQDPAKSQALESCLWELEVLQQHYHGDVVRAANVISRALSAQESDVSGLLEMSSCELFDKEMKKKFKSVPLEYEPVRGLLGLKSDITAEHFTF . In recombinant form, it is typically produced with an N-terminal His-tag to facilitate purification .
While comprehensive tissue-specific expression data for Noc4l-b in Xenopus laevis is limited in the provided search results, inferences can be made from related studies. In mice, NOC4L has been shown to be predominantly expressed in adipose tissue macrophages (ATMs), as demonstrated by co-localization with macrophage markers F4/80 and Mac-2 . In Xenopus laevis, the expression of Noc4l-b has been detected in embryos using Western blotting with specific antibodies . Further studies are needed to fully characterize the tissue-specific expression patterns of Noc4l-b throughout Xenopus development and in adult tissues. Researchers investigating expression patterns should consider using techniques such as in situ hybridization, immunohistochemistry with specific antibodies, and qRT-PCR analysis of different tissue samples at various developmental stages.
While specific data on post-translational modifications (PTMs) of Noc4l-b in Xenopus laevis is not explicitly detailed in the provided search results, this represents an important research direction. Based on the protein sequence, Noc4l-b contains multiple potential phosphorylation, glycosylation, and ubiquitination sites that could influence its function. To investigate these PTMs, researchers should employ mass spectrometry-based proteomics approaches on purified native Noc4l-b from different tissues or developmental stages of X. laevis. Phospho-specific antibodies could be developed to monitor context-dependent phosphorylation. Site-directed mutagenesis of potential PTM sites in recombinant Noc4l-b followed by functional assays would help determine the importance of specific modifications. Given Noc4l's role in inflammatory responses in mammals , researchers should particularly investigate whether PTMs change upon inflammatory stimuli in X. laevis macrophages.
Elucidating protein-protein interactions of Noc4l-b is crucial for understanding its function in X. laevis. Researchers should employ multiple complementary approaches to map its interactome. Co-immunoprecipitation using anti-Noc4l-b antibodies followed by mass spectrometry can identify native interaction partners. Yeast two-hybrid screens using Noc4l-b as bait can discover direct binding partners. Proximity-based labeling methods like BioID or APEX2 fused to Noc4l-b can identify proteins in close proximity in living cells. Based on mammalian studies showing Noc4l's involvement in TLR4/TRIF signaling , researchers should specifically investigate whether Xenopus Noc4l-b interacts with components of TLR signaling pathways. Validation of key interactions should be performed using techniques such as FRET/BRET, in vitro binding assays with purified proteins, and co-localization studies. Domain mapping experiments using truncated versions of Noc4l-b would help identify specific regions involved in each interaction.
Escherichia coli is a proven expression system for producing recombinant Xenopus laevis Noc4l-b protein. As detailed in the search results, recombinant His-tagged Noc4l-b has been successfully expressed in E. coli . Similarly, other Xenopus proteins like xPNAS-4 have been expressed in E. coli as insoluble inclusion bodies, which were subsequently solubilized and refolded . For researchers seeking alternative expression systems with potentially improved folding and post-translational modifications, insect cell expression systems (baculovirus) or mammalian expression systems (HEK293 or CHO cells) could be explored, although these are not specifically documented for Noc4l-b in the provided search results.
According to available specifications, purified recombinant Noc4l-b should be stored at -20°C/-80°C upon receipt, and aliquoting is necessary for multiple use to avoid repeated freeze-thaw cycles . For working aliquots, storage at 4°C for up to one week is recommended . The protein is typically stored in Tris/PBS-based buffer containing 6% Trehalose at pH 8.0 . When reconstituting lyophilized protein, it should be dissolved in deionized sterile water to a concentration of 0.1-1.0 mg/mL, and addition of 5-50% glycerol (final concentration) is recommended for long-term storage . The default final concentration of glycerol is typically 50% .
To optimize soluble expression and yield of recombinant Noc4l-b, researchers should consider multiple approaches:
Expression optimization table:
| Parameter | Standard Condition | Optimization Strategies |
|---|---|---|
| E. coli strain | BL21(DE3) | Test BL21(DE3)pLysS, Rosetta, Arctic Express, SHuffle |
| Expression temperature | 37°C | Lower to 16-25°C for improved folding |
| Induction conditions | 1mM IPTG | Test range from 0.1-0.5mM IPTG |
| Co-expression | None | Co-express with chaperones (GroEL/ES, DnaK) |
| Fusion tags | His-tag only | Test MBP, GST, SUMO, or thioredoxin fusions |
| Media composition | LB | Use enriched media (TB, 2YT) or autoinduction media |
| Expression time | 4 hours | Extend to overnight at lower temperatures |
If Noc4l-b forms inclusion bodies similar to xPNAS-4 , optimization of refolding protocols is critical. Researchers should perform stepwise dialysis for urea removal, starting from 8M urea and gradually reducing concentration. Addition of oxidation/reduction pairs (such as reduced/oxidized glutathione) can facilitate correct disulfide bond formation. Testing different pH conditions, salt concentrations, and additives (arginine, sucrose, glycerol) can significantly improve refolding efficiency. Alternatively, on-column refolding during purification may yield better results for some protein preparations.
Assessing structural integrity and biological activity of purified recombinant Noc4l-b requires a multi-faceted approach:
Structural analysis methods:
Circular dichroism (CD) spectroscopy to evaluate secondary structure content
Thermal shift assays to determine protein stability
Size exclusion chromatography to assess oligomerization state
Limited proteolysis to evaluate folding quality
Dynamic light scattering (DLS) to evaluate homogeneity
Functional validation approaches:
Development of specific enzyme/activity assays based on known functions
Binding assays with identified interaction partners
Cell-based assays measuring complementation of Noc4l-deficient cells
Evaluation of pro-inflammatory cytokine modulation in macrophage-based assays
For Noc4l-b specifically, researchers should consider developing functional assays based on its role in macrophage polarization and inflammatory response in mammalian systems . This could include testing the recombinant protein's ability to modulate LPS-induced inflammatory responses in Xenopus macrophage cultures or evaluating its binding to components of the TLR4/TRIF signaling pathway. Additionally, complementation experiments in Noc4l-knockout cells could validate biological activity.
While the specific functions of Noc4l-b in Xenopus laevis are not extensively detailed in the provided search results, insights can be drawn from mammalian studies. In mammals, Noc4l plays a significant role in regulating inflammatory responses in macrophages. Specifically, macrophage-specific deletion of Noc4l aggravates high-fat diet (HFD)-induced inflammation in mice . Noc4l deficiency promotes M1-like macrophage polarization, which increases inflammatory states . Given the conserved nature of many immune pathways between Xenopus and mammals , similar functions may exist in Xenopus laevis. Further research is needed to directly characterize Noc4l-b functions in Xenopus, which should include knockout or knockdown studies followed by comprehensive phenotypic analysis, particularly of immune cell function and inflammatory responses.
The regulation of Noc4l expression has been studied in mammalian systems, providing potential insights for Xenopus research. In mammals, Noc4l expression in macrophages is affected by treatment with lipopolysaccharide (LPS) and palmitic acid (PA), which are related to obesity-induced inflammation and insulin resistance . Interestingly, glucose levels have been identified as a factor negatively correlated with Noc4l transcripts in mammalian systems . This suggests that metabolic conditions may regulate Noc4l expression. For Xenopus laevis specifically, researchers should investigate Noc4l-b expression under various physiological challenges, including infection, metabolic stress, and developmental transitions. Quantitative RT-PCR, Western blotting with specific antibodies, and in situ hybridization techniques would be appropriate for such studies.
Based on mammalian studies, researchers investigating Noc4l-b's role in Xenopus laevis inflammatory responses should consider several experimental approaches:
Research design for inflammatory response analysis:
| Experimental Approach | Methodology | Readouts | Control Conditions |
|---|---|---|---|
| Noc4l-b knockdown | siRNA or CRISPR in macrophages | Cytokine expression | Scrambled siRNA |
| Noc4l-b overexpression | Transfection of Noc4l-b construct | Macrophage polarization markers | Empty vector |
| Inflammatory stimulation | LPS or PA treatment | IL-6, TNFα expression | Unstimulated cells |
| Signaling pathway analysis | Inhibitors of TLR4/TRIF pathway | NFκB nuclear translocation | DMSO vehicle |
| Macrophage polarization | IL-4 vs. LPS treatment | M1/M2 marker expression | Unpolarized macrophages |
In mammalian systems, Noc4l deficiency promotes M1-like macrophage polarization and increases expression of pro-inflammatory cytokines like IL-6 and TNFα upon LPS stimulation . The expression of anti-inflammatory markers like IL-10 and M2 macrophage markers like Arg1 and Mrc1 is reduced in Noc4l-deficient macrophages . Researchers should determine if similar patterns exist in Xenopus by isolating macrophages from different tissues, manipulating Noc4l-b expression, and analyzing inflammatory responses using qRT-PCR, ELISAs, and flow cytometry for cell surface polarization markers.
To elucidate signaling pathways that interact with Noc4l-b during immune responses in Xenopus laevis, researchers should design experiments that probe established inflammatory signaling cascades. In mammalian systems, Noc4l is implicated in TLR4/TRIF signaling . The expression of TLR4 and CD14 was not altered in Noc4l-deficient macrophages, suggesting Noc4l acts downstream of these receptors .
Researchers should investigate:
TLR signaling: Using specific agonists for different TLRs (Pam3CSK4 for TLR2, poly(I:C) for TLR3, LPS for TLR4) to determine which pathways are modulated by Noc4l-b
Downstream adaptor molecules: Examining interactions with MyD88, TRIF, TRAM, and TIRAP through co-immunoprecipitation studies
Activation of transcription factors: Measuring nuclear translocation of NFκB, IRF3, and AP-1 in Noc4l-b-depleted vs. control cells
Kinase activation patterns: Assessing phosphorylation of p38, JNK, and ERK MAPKs following immune stimulation
Cytokine receptor signaling: Investigating how Noc4l-b affects responses to IL-4, IL-13, and IFNγ
Phosphoproteomic analysis comparing wild-type and Noc4l-b-deficient cells following immune stimulation could provide a global view of affected signaling pathways. Transcriptomic analysis would complement this by identifying gene expression networks influenced by Noc4l-b during immune responses in Xenopus macrophages.
While the search results don't specifically mention commercially available antibodies against Xenopus laevis Noc4l-b, they do provide insights into antibody development for similar Xenopus proteins. For instance, antibodies have been developed against xPNAS-4, another Xenopus protein, using purified recombinant protein to raise polyclonal antibodies suitable for detecting protein expression in X. laevis embryos by Western blotting . Similarly, for NOC4L in other species, both mouse monoclonal antibody (3L7) and rabbit polyclonal antibody (6R) have been prepared and validated for specificity . Researchers interested in Noc4l-b antibodies should either explore these existing resources or consider developing custom antibodies using purified recombinant Xenopus laevis Noc4l-b protein as an immunogen.
To validate the specificity of anti-Noc4l-b antibodies, researchers should employ multiple complementary approaches as demonstrated in the literature. One effective approach is to use a NOC4L-Flag vector to overexpress NOC4L and then detect the expression with the antibody in question . Additionally, validating antibody specificity in Noc4l-ablated cells, such as bone-marrow-derived macrophages (BMDMs), provides strong evidence of specificity . Western blotting, immunoprecipitation, and immunofluorescence with appropriate positive and negative controls are essential validation techniques. For Xenopus-specific applications, performing Western blots on tissue lysates from different developmental stages and comparing results with mRNA expression patterns can provide further validation. Cross-reactivity testing with related proteins and pre-absorption tests with the immunizing antigen should also be conducted to ensure specificity.
Developing custom antibodies against Xenopus laevis Noc4l-b requires careful planning and execution:
Antibody development strategy:
For specialized applications such as ChIP, super-resolution microscopy, or in vivo imaging, additional conjugation steps may be required. For example, antibodies can be directly labeled with fluorophores for live imaging, or with HRP/AP for enhanced detection sensitivity in blotting applications. Site-specific conjugation techniques using engineered cysteines or enzymatic approaches (sortase, transglutaminase) can improve antibody performance in demanding applications by ensuring the antigen-binding site remains unobstructed.
Based on mammalian studies, Noc4l-b has potential as a marker for specific cellular processes in Xenopus immunological research:
1. Macrophage polarization marker: In mammals, Noc4l deficiency promotes M1-like macrophage polarization while reducing M2 macrophage markers . Researchers could develop assays where Noc4l-b expression levels serve as indicators of macrophage polarization states in Xenopus.
2. Metabolic stress indicator: The negative correlation between Noc4l expression and glucose levels in mammalian systems suggests Noc4l-b might serve as a marker for metabolic stress in Xenopus cells.
3. Inflammatory response dynamics: Since Noc4l influences inflammatory cytokine production in mammals , monitoring Noc4l-b localization and expression during immune challenges could provide insights into the inflammatory response timeline.
For these applications, researchers should develop:
Fluorescently-tagged Noc4l-b constructs for live imaging
Phospho-specific antibodies to track activation states
FRET-based biosensors to monitor Noc4l-b interactions with signaling components
Quantitative assays correlating Noc4l-b levels with cellular phenotypes
Additionally, researchers could explore single-cell transcriptomics and proteomics approaches to identify cell populations where Noc4l-b serves as a defining marker, potentially uncovering previously uncharacterized immune cell subsets in the Xenopus system.
For cross-species functional studies of Noc4l, researchers should consider multiple experimental models with complementary strengths. Xenopus laevis offers advantages for developmental and cell biological studies due to its large eggs and easily manipulated embryos , while mammalian models provide better insights into metabolic and inflammatory diseases. For in vitro studies, primary macrophages isolated from both Xenopus and mammals (typically mice) allow direct comparison of Noc4l function in comparable cell types. Cell lines from both species can be engineered for Noc4l knockout using CRISPR/Cas9, enabling rescue experiments with cross-species Noc4l variants. For in vivo studies, while X. laevis has genetic limitations due to its allotetraploid genome and long generation time , X. tropicalis offers a more genetically tractable amphibian model. Mouse models with tissue-specific Noc4l deletion (e.g., macrophage-specific deletion using LysM-Cre) provide mammalian comparisons. The choice of model should be guided by the specific research question, with consideration of phylogenetic distance when interpreting results.
To understand how evolutionary differences in Noc4l-b reflect adaptation to diverse immunological challenges, researchers should conduct a comprehensive evolutionary analysis:
Evolutionary analysis framework:
| Analytical Approach | Methodology | Expected Insights |
|---|---|---|
| Phylogenetic analysis | Maximum likelihood/Bayesian methods | Evolutionary history and divergence rates |
| Selection pressure analysis | dN/dS ratios, PAML, FUBAR | Positively/negatively selected residues |
| Structural modeling | Homology modeling, molecular dynamics | Functional implications of sequence changes |
| Domain conservation analysis | Multiple sequence alignment, ConSurf | Identification of invariant functional motifs |
| Lineage-specific changes | Branch-site models | Adaptive changes in specific lineages |
Particular attention should be paid to comparing Noc4l between species with different immune challenges. For instance, comparing aquatic (Xenopus) vs. terrestrial vertebrates may reveal adaptations to different pathogen exposures. Analysis of rapid evolution "hotspots" within the protein sequence could identify regions involved in pathogen recognition or immune signaling adaptation. Experimental validation of these evolutionary insights could involve creating chimeric proteins with domains from different species or site-directed mutagenesis of lineage-specific residues followed by functional testing in inflammatory response assays.
Comparative analysis of Noc4l-b-mediated signaling across species can provide profound insights into both conserved immune mechanisms and species-specific adaptations:
1. Core signaling module identification: Signaling components that interact with Noc4l-b across diverse species (from Xenopus to mammals) likely represent an ancient, conserved immune signaling module. These components should be identified through comparative interactomics using techniques like BioID or co-immunoprecipitation followed by mass spectrometry in multiple species.
2. Divergent pathway connections: While core functions may be conserved, Noc4l-b might connect to different downstream pathways in different species. Comparative phosphoproteomics and transcriptomics following Noc4l-b perturbation across species could reveal these divergent connections.
3. Stimulus-response relationship: The threshold and dynamics of Noc4l-b-mediated responses to stimuli like LPS may differ between species. Dose-response and time-course experiments comparing Xenopus and mammalian cells could identify these differences.
4. Metabolic integration: Given Noc4l's correlation with glucose levels in mammals , comparing how Noc4l-b integrates metabolic signals across species might reveal evolutionary adaptations in immuno-metabolic crosstalk.
5. Developmental context: Comparing the developmental regulation of Noc4l-b across species could provide insights into how immune system development has evolved. This is particularly relevant when comparing Xenopus (which undergoes metamorphosis) with mammals.
These comparative approaches could ultimately help identify both fundamental principles of immune signaling and potential species-specific targets for therapeutic intervention in inflammatory diseases.