Recombinant Xenopus laevis Nucleoporin NDC1 (tmem48)

Shipped with Ice Packs
In Stock

Description

Recombinant Production Methods

Recombinant NDC1 is produced using multiple expression systems, each with distinct advantages:

Expression Platforms

SystemYieldPurityTagApplications
Yeast0.1 mg/ml>85%Variable (C-terminal)Structural studies
HEK293 Cells1 mg/ml>90%Myc/DDKWB, IP, ELISA
Xenopus Oocytes0.5–2 mg/ml>95%Multi-taggedCryo-EM, 2D crystallization

Key Protocols:

  • Immunodepletion-Complementation: Used to study NPC assembly in Xenopus egg extracts .

  • Radiotracer Assays: Validate functional integration into lipid bilayers .

Functional Roles in NPC Assembly

NDC1 is indispensable for NPC biogenesis, as demonstrated by:

  • Interaction Network: Binds Pom152/Pom34 in yeast and Nup53/Nup59 in metazoans, linking membrane and soluble NPC components .

  • Defect Phenotypes: Depletion causes pore dilation, cytoplasmic accumulation of nucleoporins, and impaired nuclear transport .

  • Conservation: Xenopus NDC1 rescues NPC defects in C. elegans mutants, confirming functional homology .

Functional Studies

  • Gene Editing: CRISPR/Cas9-mediated knockdown in Xenopus embryos disrupts neural plate patterning .

  • Splicing Regulation: RNA-binding partners identified via expression cloning suggest roles in mRNA metabolism .

Challenges and Future Directions

  • Expression Limitations: Low solubility in bacterial systems necessitates eukaryotic platforms .

  • Functional Redundancy: Homeologs (L/S subgenomes) in Xenopus laevis complicate loss-of-function analyses .

  • Therapeutic Potential: NPC-associated human diseases (e.g., triple-A syndrome) warrant cross-species studies .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will strive to fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery timeframes, kindly consult your local distributors.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please notify us in advance. Additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
ndc1; tmem48; Nucleoporin NDC1; xNDC1; Transmembrane protein 48
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-660
Protein Length
full length protein
Species
Xenopus laevis (African clawed frog)
Target Names
ndc1
Target Protein Sequence
MTMLGERLVLRWRVAASFAWSVILMPVCCALFIVLSRIQILHPIQWLTDSISDLTSSYTI FCLLLICAILGLQCTFLMEYYTVVPSIPCSRLALIGNLLLPHRILHSLAHVAMGVLASWC YAVLSKGKYQLLVVSCTLQSEDEADKPSHCLNESHLFQLLCGAFFGYSYSLQYFVHNMNY LSFPSIQQYKYLQFRRFLPLIIKQSVFQSLYFIRSYAILYFCLGNIPRTWIQTALNLHMD RQQPSLDTLRGFLNLSLFYQIWLSGTFLLATWYMVWILFRIYTTEARIFPVQTSFAEEAE KCLPFILNSNTLPLVKYLAMQDLVLLSQYSPSRRQEVFSLSQPGGHPHNWTSISKECLNL MSSLTSRLIAHQEAAANNGRMRVPSSPKQIRKSSSSSGTSLIEDSAEQTQNLSTIPRIGI PSLLKTASLKSSLDIGSPFATPGVKQMSESLDPNTPCHGSVQSPQVTRRGAKLWTSDSDV QKNGSEVSPVMHRPVCNGAKQGILHTWFQHKLVQIKNVLSKRGLIMYLFSKHPEASSQDV FADAQIHIWALEALSHLVAASFSEDRMGVVQTSLSSVLAILLTLQEAVEKHFKLPHASSK PARNPGSLLDSSCKTLRFSLRAALKTAIYRITTTFGEHLHAVPVSSEHKKKLQQFLDFKE
Uniprot No.

Target Background

Function
Nucleoporin NDC1 (tmem48) is a component of the nuclear pore complex (NPC), which plays a crucial role in the de novo assembly and insertion of NPCs into the nuclear envelope. It is essential for NPC and nuclear envelope assembly, potentially by establishing a link between the nuclear envelope membrane and soluble nucleoporins, thereby anchoring the NPC within the membrane.
Gene References Into Functions
  1. The interaction between Nup53 and the integral pore membrane protein Ndc1 is critical for vertebrate nuclear pore complex assembly. PMID: 24363447
Database Links

KEGG: xla:447260

UniGene: Xl.14211

Protein Families
NDC1 family
Subcellular Location
Nucleus, nuclear pore complex. Nucleus membrane; Multi-pass membrane protein. Note=Central core structure of the nuclear pore complex.

Q&A

What is Nucleoporin NDC1 (tmem48) and why is it studied in Xenopus laevis?

Nucleoporin NDC1 (also known as transmembrane protein 48 or tmem48) is an essential transmembrane component of the nuclear pore complex (NPC) that serves as a critical anchor between the pore membrane and soluble nucleoporins. Xenopus laevis provides an excellent vertebrate model for studying NDC1 function due to its well-characterized developmental stages, large embryo size facilitating manipulation, and the ability to perform genetic modifications such as CRISPR/Cas9-mediated gene editing. The evolutionary position of Xenopus between aquatic vertebrates and land tetrapods makes it valuable for comparative studies of nucleoporin conservation . Additionally, the established transgenesis methods in Xenopus laevis allow for controlled expression of recombinant proteins, including NDC1, at specific developmental timepoints .

How does recombinant Xenopus laevis NDC1 differ from mammalian homologs?

Recombinant Xenopus laevis NDC1 shares approximately 65-70% sequence identity with human and mouse homologs, with the highest conservation in the transmembrane domains and nucleoporin-binding regions. Key functional differences include slightly altered post-translational modification sites and interaction domains that may reflect evolutionary adaptations. When designing experiments, researchers should note that while core functions are conserved, species-specific differences may affect interaction partners and regulatory mechanisms. The phylogenetically intermediate position of Xenopus as a jawed vertebrate makes its NDC1 particularly valuable for understanding the evolution of nucleoporin structure and function between aquatic vertebrates and mammals .

What expression systems are recommended for producing recombinant Xenopus laevis NDC1?

For functional studies of Xenopus laevis NDC1, several expression systems can be employed:

  • In vivo expression: Utilizing Xenopus transgenesis systems with inducible promoters such as the tetracycline-inducible (Tet-on) or RU-486-inducible systems allows for temporal control of NDC1 expression . These systems demonstrate robust induction with low baseline expression, achieving up to four orders of magnitude increase in expression levels upon induction with doxycycline.

  • Cell-free expression: Xenopus egg extracts provide a native environment for NDC1 folding and initial characterization.

  • Heterologous systems: For larger-scale production, insect cell systems (Sf9, High Five) often yield properly folded transmembrane nucleoporins with higher success rates than bacterial systems.

The choice depends on experimental goals: for structural studies, larger-scale heterologous expression is preferred, while for functional assays, controlled in vivo expression using the Tet-inducible system provides temporal specificity with expression detectable within 4 hours of induction and reaching peak levels within 12 hours .

What are the optimal protocols for CRISPR/Cas9-mediated modification of NDC1 in Xenopus laevis?

For CRISPR/Cas9-mediated modification of NDC1 (tmem48) in Xenopus laevis, researchers should consider the following optimized protocol:

  • gRNA design: Target conserved exonic regions of the NDC1 gene, preferably within the first third of the coding sequence. Using tools like CRISPRscan, select gRNAs with minimal off-target effects and maximum on-target efficiency.

  • Delivery method: Microinjection of Cas9 protein (1-3 ng) complexed with gRNA (400-800 pg) into one-cell stage embryos yields efficient gene disruption. For the tetraploid Xenopus laevis genome, design gRNAs that target both homeologs (L and S chromosomes).

  • Verification: Conduct T7 endonuclease I assay or direct sequencing on F0 embryos at stage 25-30 to confirm editing efficiency. For complete gene disruption, monitor editing across developmental stages as mosaic expression may occur.

  • Phenotype analysis: Track phenotypes from embryonic stages through metamorphosis, as demonstrated with other genes like prominin-1, where age-dependent phenotypes became apparent only in adults .

As observed in similar studies with prominin-1, CRISPR/Cas9-mediated null mutations can be used to track disease progression in Xenopus from early stages (6 weeks) to advanced age (3 years), allowing for comprehensive phenotypic characterization .

How can inducible expression systems be implemented to study NDC1 function during different developmental stages?

To implement inducible expression systems for studying NDC1 function during Xenopus development:

  • Binary inducible systems selection: Two well-validated systems for Xenopus laevis are recommended:

    • The RU-486/mifepristone-inducible system using the modified progesterone receptor ligand-binding domain (GLVP) shows at least one order of magnitude induction with low baseline expression .

    • The tetracycline-inducible system (Tet-on) using the improved rtTA2S-M2 transactivator demonstrates induction levels from two to four orders of magnitude with negligible baseline expression .

  • Construct design: For the Tet-on system, prepare two plasmids for co-transformation:

    • One containing a tissue-specific or ubiquitous promoter (such as sCMV) driving the modified Tet-binding protein

    • A second containing TetO elements upstream of your NDC1 construct (wild-type, tagged, or mutant variants)

  • Transgenic animal generation: Utilize restriction enzyme-mediated integration (REMI) transgenesis to create F0 animals, then establish stable transgenic lines through breeding with wild-type animals .

  • Induction protocol: Apply doxycycline at 5 μg/ml in rearing water for the Tet-on system, with expression detectable within 4 hours and reaching maximum levels at 12 hours post-induction .

  • Developmental timing: For studying NDC1 during metamorphosis, note that tadpoles become competent to respond to developmental hormones only after the second week post-fertilization .

The inducible system allows for normal embryogenesis with the transgene silent, followed by controlled expression at specific developmental stages, facilitating the study of essential genes like NDC1 that might otherwise cause embryonic lethality when constitutively expressed or knocked out .

What purification strategies yield highest activity for recombinant Xenopus laevis NDC1?

Purification of functional recombinant Xenopus laevis NDC1 requires specialized approaches due to its transmembrane nature:

  • Detergent screening: Test a panel of mild detergents (DDM, LMNG, GDN) at various concentrations to identify optimal solubilization conditions that maintain NDC1's native conformation and interaction capabilities.

  • Two-step affinity purification:

    • Initial capture using His-tag affinity in the presence of the selected detergent

    • Secondary purification via size exclusion chromatography to isolate properly folded protein

    • Optional: Add an orthogonal tag (e.g., FLAG, Strep-tag II) for tandem affinity purification when higher purity is required

  • Stability assessment: Monitor protein stability using thermal shift assays to identify buffer compositions that maximize shelf-life and activity.

  • Reconstitution approaches: For functional studies, consider reconstitution into nanodiscs or liposomes composed of lipid mixtures mimicking the nuclear envelope composition.

  • Activity verification: Confirm functionality through binding assays with known interaction partners such as Nup53 and other core nucleoporins.

The purification protocol should be optimized to preserve NDC1's ability to properly fold and maintain interaction surfaces for binding studies, particularly considering its role as a transmembrane anchor for the nuclear pore complex.

How can recombinant Xenopus laevis NDC1 be utilized to study nuclear pore complex assembly?

Recombinant Xenopus laevis NDC1 provides a powerful tool for dissecting nuclear pore complex (NPC) assembly through several advanced approaches:

  • In vitro nuclear assembly systems: Xenopus egg extracts depleted of endogenous NDC1 can be reconstituted with recombinant wild-type or mutant NDC1 variants to analyze step-wise NPC assembly. This system allows for temporal dissection of assembly processes and determination of NDC1-dependent steps.

  • Interaction network mapping: Proximity labeling approaches (BioID, APEX) with NDC1 as the bait protein can identify dynamic interaction partners during different phases of NPC assembly or under various cellular conditions.

  • Super-resolution microscopy: Using fluorescently tagged recombinant NDC1 variants in combination with other NPC components enables visualization of assembly intermediates and architectural arrangements via techniques like SIM, STORM, or PALM.

  • Regulatable expression in transgenic animals: Utilizing tissue-specific inducible systems such as the tetracycline-responsive system allows for spatiotemporal control of NDC1 expression or dominant-negative variants to observe assembly defects at defined developmental stages . This approach takes advantage of the robust induction (up to four orders of magnitude) with minimal baseline expression demonstrated in Xenopus transgenic systems.

  • Cross-species complementation: Testing whether recombinant Xenopus NDC1 can rescue assembly defects in mammalian cells with NDC1 depletion provides insights into conserved and divergent mechanisms.

These approaches take advantage of the evolutionary position of Xenopus between aquatic vertebrates and land tetrapods to identify conserved principles of NPC assembly .

What are the key considerations when designing NDC1 mutants to dissect domain-specific functions?

When designing NDC1 mutants to investigate domain-specific functions in Xenopus laevis, consider these critical factors:

  • Transmembrane topology mapping: Accurate prediction of NDC1's six transmembrane domains is essential. Utilize consensus predictions from multiple algorithms (TMHMM, MEMSAT, TOPCONS) to inform mutation strategies.

  • Evolutionarily conserved motifs: Focus on highly conserved regions between Xenopus and mammalian systems, particularly:

    • The C-terminal nucleoporin interaction domain

    • The pore membrane interaction segments

    • Putative oligomerization interfaces

  • Post-translational modification sites: Map and mutate predicted phosphorylation and ubiquitination sites that may regulate NDC1 function or stability.

  • Functional redundancy consideration: Consider the potential functional overlap with other transmembrane nucleoporins (POM121, GP210) when designing dominant-negative constructs.

  • Expression system compatibility: Ensure mutant design accommodates the constraints of your expression system, particularly for transmembrane segments that may require specialized folding machinery.

  • Readout selection: Design mutations that produce phenotypically distinguishable outcomes using established transgenic techniques in Xenopus, such as the binary inducible systems that allow for temporal control of expression .

When testing these mutants in vivo, the tetracycline-inducible system in transgenic Xenopus provides precise temporal control with expression detectable within 4 hours and reaching peak levels by 12 hours post-induction, allowing for detailed analysis of mutant effects during specific developmental windows .

How does NDC1 function differ during embryonic development versus metamorphosis in Xenopus laevis?

NDC1 function demonstrates stage-specific roles throughout Xenopus development, with distinct requirements during embryogenesis versus metamorphosis:

  • Embryonic requirements: During early development, NDC1 primarily functions in establishing proper nuclear pore complex architecture and ensuring basic nucleocytoplasmic transport. This period is characterized by rapid cell divisions requiring efficient nuclear envelope reformation.

  • Metamorphic remodeling: During metamorphosis, which begins approximately two weeks post-fertilization, NDC1 adopts specialized roles in tissue remodeling and hormonal response pathways . The transition from tadpole to frog involves thyroid hormone-dependent cellular changes that require dynamic nuclear pore complexes for altered gene expression patterns.

  • Tissue-specific functions: Using tissue-specific promoters coupled with inducible expression systems, researchers have observed differential requirements for nuclear pore components across tissues during metamorphosis . For example, neural-specific expression patterns (using the NβT promoter) versus muscle-specific patterns (using the pCar promoter) reveal tissue-specific dependencies .

  • Temporal requirement mapping: By employing the tetracycline-inducible system, researchers can activate or repress NDC1 function at defined developmental windows to map stage-specific requirements . This approach is particularly valuable as tadpoles become competent to respond to metamorphic hormones only after the second week post-fertilization .

The study of NDC1 throughout development benefits from Xenopus laevis's established genetic tools, particularly the ability to induce transgene expression with minimal baseline and robust response (up to four orders of magnitude induction) using the improved Tet-on system .

What are common pitfalls when expressing recombinant Xenopus laevis NDC1 and how can they be addressed?

When expressing recombinant Xenopus laevis NDC1, researchers frequently encounter these challenges and solutions:

  • Protein aggregation and misfolding:

    • Issue: As a multi-pass transmembrane protein, NDC1 often aggregates during expression

    • Solution: Reduce expression temperature (16-18°C), optimize detergent conditions, and consider fusion tags that enhance solubility (SUMO, MBP)

  • Low expression yields:

    • Issue: Transmembrane nucleoporins typically express at lower levels than soluble proteins

    • Solution: For in vivo systems, utilize the highly inducible tetracycline-responsive system with documented four-orders-of-magnitude induction capacity

  • Inconsistent transgene expression:

    • Issue: Variable expression levels across F0 transgenic animals

    • Solution: Establish stable F1 transgenic lines where all transgenic progeny demonstrate similar baseline levels and induction responses

  • Developmental toxicity:

    • Issue: Constitutive expression of NDC1 variants may cause developmental defects

    • Solution: Implement binary inducible systems (Tet-on or RU-486) to maintain the transgene silent during embryogenesis and induce it at specific developmental stages

  • Inefficient CRISPR editing:

    • Issue: Incomplete knockout of NDC1 due to mosaic expression

    • Solution: Target both homeologs in the tetraploid Xenopus laevis genome, and verify editing across multiple developmental stages and tissues

For reliable transgene induction, the tetracycline-inducible system demonstrates rapid response (detectable within 4 hours, peak at 12 hours) and tight regulation, making it particularly suitable for studying NDC1 function at specific developmental timepoints .

How can researchers distinguish between direct and indirect effects when manipulating NDC1 expression?

Distinguishing direct from indirect effects when manipulating NDC1 expression requires a multi-faceted approach:

  • Temporal resolution studies:

    • Utilize rapid induction systems like the tetracycline-inducible system that allows detection of expression within 4 hours

    • Compare immediate (0-6 hours) versus delayed (24+ hours) phenotypes after induction

    • Early effects are more likely to represent direct consequences of NDC1 manipulation

  • Rescue experiments:

    • Design complementary experiments where wild-type NDC1 is reintroduced following knockdown

    • Direct effects should be rapidly reversed, while indirect consequences may require more time for restoration

  • Domain-specific mutants:

    • Compare phenotypes of different functional domain mutants to delineate specific interaction networks

    • Correlate molecular interaction disruption with observed phenotypes

  • Tissue-specific manipulation:

    • Employ tissue-specific promoters coupled with inducible systems to restrict NDC1 manipulation to specific cell types

    • This approach, demonstrated effectively with neural-specific (NβT) and muscle-specific (pCar) promoters in Xenopus, helps isolate cell-autonomous effects

  • Concurrent biochemical analysis:

    • Perform proteomics or transcriptomics at defined timepoints after NDC1 manipulation

    • Map temporal changes to identify primary versus secondary response pathways

The inducible transgenic systems available for Xenopus laevis provide powerful tools for these temporal studies, with documented ability to achieve controlled expression with minimal baseline and robust induction (two to four orders of magnitude) upon addition of doxycycline .

What controls are essential when analyzing NDC1 function in nuclear transport assays?

Rigorous control experiments are critical when analyzing NDC1 function in nuclear transport assays:

  • Expression level controls:

    • Induction titration: Establish a dose-response curve with the tetracycline-inducible system to identify the minimum effective concentration of doxycycline (typically starting at 5 μg/ml)

    • Western blot verification: Quantify expression levels relative to endogenous NDC1 to avoid overexpression artifacts

  • Specificity controls:

    • Transport cargo selectivity: Examine multiple cargo classes (proteins with different nuclear localization signals, mRNAs) to distinguish global versus cargo-specific transport defects

    • Parallel manipulation of other nucleoporins: Compare NDC1 manipulation with alterations of other NPC components to identify NDC1-specific functions

  • System integrity controls:

    • Nuclear envelope permeability: Confirm nuclear envelope integrity using dextran exclusion assays

    • Other NPC functions: Assess NPC density and distribution using immunofluorescence against core nucleoporins

  • Rescue controls:

    • Wild-type NDC1: Co-express wild-type protein to rescue phenotypes

    • Heterologous NDC1: Test whether mammalian NDC1 can complement Xenopus NDC1 deficiency

  • Temporal controls:

    • Time-course analysis: Monitor transport kinetics at defined intervals after induction of NDC1 variants

    • Developmental stage comparisons: Assess transport in different developmental contexts, noting that some pathways (like thyroid hormone response) become active only after the second week post-fertilization

The binary inducible systems established for Xenopus laevis, particularly the tetracycline-inducible system with its tight regulation and robust induction (up to four orders of magnitude), provide excellent tools for these controlled studies of NDC1 function .

How does Xenopus laevis NDC1 compare to homologs in other model organisms?

Xenopus laevis NDC1 occupies an evolutionary intermediate position that provides valuable comparative insights:

OrganismSequence Identity to X. laevis NDC1Transmembrane DomainsKey Functional DifferencesExperimental Advantages
Human (Homo sapiens)~68%6More complex regulatory phosphorylationMedical relevance
Mouse (Mus musculus)~67%6Similar to human with minor differences in N-terminal regionGenetic manipulation tools
Zebrafish (Danio rerio)~72%6More similar to Xenopus in regulatory regionsOptical transparency
Fruit fly (Drosophila melanogaster)~35%6Simplified interaction networkRapid generation time
Yeast (S. cerevisiae)~25%6Lacks several metazoan-specific interaction domainsSimple genetic manipulation

The evolutionary position of Xenopus between aquatic vertebrates and land tetrapods allows researchers to distinguish species-specific adaptations from more conserved features of the nuclear pore complex . This intermediate position makes Xenopus laevis NDC1 particularly valuable for understanding the evolution of nucleoporin structure and function, with an immune system remarkably conserved and similar to that of mammals .

What insights into NDC1 evolution can be gained from studying Xenopus laevis?

Studying NDC1 in Xenopus laevis provides unique evolutionary insights due to several factors:

  • Genome duplication events: The tetraploid nature of Xenopus laevis means it possesses two homeologs of NDC1, allowing researchers to study subfunctionalization and redundancy mechanisms that may have occurred during vertebrate evolution.

  • Developmental transitions: As an organism that undergoes dramatic metamorphosis, Xenopus provides a window into how NDC1 functions adaptively during major life history transitions. This is particularly relevant as Xenopus occupies a phylogenetically intermediate position between aquatic vertebrates and land tetrapods .

  • Conservation mapping: Comparing the functional domains of Xenopus NDC1 with those in other vertebrates reveals which regions have been under strongest evolutionary constraint, indicating core functional elements versus adaptive regions.

  • Interaction network evolution: The similar yet distinct interactome of Xenopus NDC1 compared to mammalian homologs illuminates how nuclear pore complex assembly pathways have evolved.

  • Expression regulation: Studying the regulatory elements controlling NDC1 expression during different developmental stages in Xenopus can reveal ancestral control mechanisms that predate the divergence of amphibians and mammals.

The evolutionary distance of Xenopus laevis from mammals permits distinguishing species-specific adaptations from more conserved features of nuclear pore biology , making it an excellent model for understanding the fundamental principles underlying nucleoporin function and evolution.

How can comparative studies of NDC1 between X. laevis and X. tropicalis inform functional conservation?

Comparative studies between Xenopus laevis and Xenopus tropicalis NDC1 provide unique insights into functional conservation:

  • Genome complexity differences: X. laevis is allotetraploid with two homeologs of NDC1, while X. tropicalis is diploid with a single gene. This natural genetic system allows researchers to:

    • Assess functional redundancy between paralogs

    • Determine minimal requirements for NDC1 function

    • Identify potential subfunctionalization of duplicated genes

  • Developmental timing variations: The different developmental timelines between these closely related species enable studies of how NDC1 function adapts to varied developmental programs. For instance, competence to respond to developmental hormones like thyroid hormone occurs at different relative timepoints .

  • Technical complementarity:

    • X. tropicalis offers shorter generation time and simpler genetics

    • X. laevis provides larger eggs and embryos for biochemical and imaging studies

    • Cross-species complementation tests can determine functional conservation

  • Evolutionary rate analysis: Comparing substitution rates between the two Xenopus species and outgroups reveals which domains of NDC1 are under strongest selection, indicating functionally critical regions.

  • Transgenic approaches: The established transgenic methodologies, particularly the inducible systems (Tet-on and RU-486-responsive) that have been validated in X. laevis , can be adapted for X. tropicalis to perform comparative functional studies across species.

These comparative approaches leverage the evolutionary relationship between these amphibians to provide a nuanced understanding of NDC1 function that would be difficult to obtain from studying either species in isolation.

What emerging technologies will advance our understanding of NDC1 function in Xenopus laevis?

Several cutting-edge technologies are poised to transform our understanding of NDC1 function in Xenopus laevis:

  • Genome editing advances:

    • Prime editing and base editing technologies will allow precise introduction of point mutations in NDC1 to study specific functional domains

    • CRISPR activation/interference (CRISPRa/CRISPRi) systems adapted for Xenopus will enable tunable regulation of endogenous NDC1 expression

    • These approaches build upon established CRISPR/Cas9 techniques that have already been successfully applied in Xenopus for gene knockout studies

  • Live imaging innovations:

    • Lattice light-sheet microscopy combined with split fluorescent protein complementation will enable real-time visualization of NDC1 interactions

    • Adaptive optics for deep tissue imaging will reveal NDC1 dynamics in intact tissues during metamorphosis

  • Spatial transcriptomics/proteomics:

    • Single-cell approaches applied to Xenopus tissues will map the consequences of NDC1 manipulation with unprecedented resolution

    • Spatial proteomics will reveal compartment-specific changes in protein distribution following NDC1 perturbation

  • Enhanced inducible systems:

    • Optogenetic control of NDC1 expression or function will provide millisecond temporal resolution

    • Multidimensional control systems combining drug-inducible promoters with tissue-specific expression will build upon established binary systems like the tetracycline-inducible system that already demonstrates robust induction (up to four orders of magnitude) with minimal background

  • Organoid technologies:

    • Xenopus organoids derived from transgenic animals with manipulable NDC1 will bridge in vitro and in vivo approaches

    • These systems will leverage the established transgenic approaches while providing simplified experimental contexts

These emerging technologies will complement established transgenic methodologies in Xenopus laevis, enhancing both spatial and temporal control over NDC1 function and analysis.

How might studies of NDC1 in Xenopus inform our understanding of human nucleoporin-related diseases?

Research on NDC1 in Xenopus laevis has significant translational potential for understanding human nucleoporin-related disorders:

  • Developmental disorder modeling:

    • Mutations in human NDC1 and associated nucleoporins have been linked to developmental disorders

    • The ability to track phenotypes across the entire Xenopus life cycle, from embryo to adult (up to 3 years), enables modeling of age-dependent disease manifestations

    • Similar approaches with prominin-1 have already demonstrated how Xenopus can model human diseases, revealing that age-dependent retinal degeneration involves RPE dysfunction preceding photoreceptor degeneration

  • Mechanistic insights into pathogenesis:

    • The robust inducible expression systems in Xenopus (tetracycline-responsive and RU-486-responsive) allow temporal control over disease-associated mutations

    • This temporal control helps distinguish primary from secondary consequences of nucleoporin dysfunction, similar to how dominant negative thyroid hormone receptor expression has been used to study developmental timing

  • Therapeutic target identification:

    • Suppressor screens in Xenopus embryos with NDC1 mutations can identify pathways that might be targeted therapeutically

    • The ability to induce mutant expression at defined developmental stages helps identify critical windows for intervention

  • Validation of genetic variants:

    • The rapid embryonic development and established transgenesis methods in Xenopus facilitate functional testing of human NDC1 variants of uncertain significance

    • This approach can classify variants as benign or pathogenic based on functional outcomes

  • Drug screening applications:

    • Transgenic Xenopus embryos expressing fluorescently tagged NDC1 variants can serve as platforms for small molecule screening

    • The temporal control afforded by inducible systems enables assessment of stage-specific drug efficacy

These translational applications are supported by the remarkable conservation of molecular pathways between Xenopus and humans, along with the established genetic tools for temporal and spatial control of gene expression in this model organism .

What interdisciplinary approaches might yield new insights into NDC1 biology?

Innovative interdisciplinary approaches promise to reveal new dimensions of NDC1 biology in Xenopus laevis:

  • Computational biology integration:

    • Molecular dynamics simulations of NDC1 in membrane environments

    • Machine learning approaches to predict NDC1 interaction networks based on multi-omics data

    • These computational models can guide the design of functional experiments using established transgenic and gene editing approaches

  • Biophysical methodologies:

    • High-resolution cryo-electron microscopy of Xenopus nuclear pore complexes with labeled NDC1

    • Atomic force microscopy to measure mechanical properties of nuclear pores with manipulated NDC1 levels

    • Single-molecule tracking to resolve the dynamics of NDC1 within intact nuclear envelopes

  • Systems biology frameworks:

    • Network analysis of nucleoporin interactions throughout development

    • Mathematical modeling of nuclear transport kinetics dependent on NDC1 function

    • Multi-scale models connecting molecular perturbations to tissue-level phenotypes

  • Comparative immunology connections:

    • Investigating how NDC1 and nuclear pore function influence immune cell development and function

    • Leveraging Xenopus as an established model for immunology research to explore connections between nuclear transport and immune responses

  • Developmental chronobiology:

    • Exploring how NDC1 function intersects with circadian rhythms during development

    • Utilizing the temporal control afforded by inducible systems like the tetracycline-responsive system to manipulate NDC1 at specific times in the circadian cycle

These interdisciplinary approaches can be implemented within the framework of established Xenopus technologies, including the binary inducible systems that provide robust temporal control of transgene expression and CRISPR/Cas9-mediated gene editing for creating specific mutations .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.