Recombinant Xenopus laevis Occludin (ocln)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Xenopus laevis Occludin (OCLN)

Recombinant Xenopus laevis Occludin (OCLN) is a purified, full-length protein engineered for research applications. It is derived from the ocln gene, which encodes an integral membrane protein critical for tight junction (TJ) function in epithelial and endothelial cells. This recombinant variant is widely used to study TJ dynamics, barrier integrity, and occludin’s role in cellular processes such as development, inflammation, and disease (e.g., cancer, metabolic disorders) .

Role in Tight Junctions

Occludin stabilizes TJ integrity by:

  1. Interacting with ZO-1: The C-terminal tail binds ZO-1, linking occludin to the cytoskeleton and enhancing barrier function .

  2. Regulating Paracellular Permeability: Phosphorylation at specific residues (e.g., S408 in human) modulates claudin-2 channel activity .

Key Interactions

Interaction PartnerRoleEvidence
CingulinCytoplasmic plaque protein; binds occludin’s C-terminal domain .
ZO-1Scaffold protein; stabilizes occludin at TJs via α-helical bundle binding .
ClaudinsForms TJ strands; occludin modulates claudin channel function .

Developmental Biology

  • Embryo Studies: Native X. laevis occludin undergoes dephosphorylation during early development, correlating with TJ assembly . Recombinant OCLN is used to model these processes in vitro.

  • Phosphorylation Dynamics: In vitro kinase assays show X. laevis occludin is phosphorylated by CK2 and p34cdc2/cyclin B, but not MAPK or CK1 .

Disease Modeling

  • Cancer: Loss of occludin correlates with epithelial leakiness and metastasis. Recombinant OCLN is used to study TJ disruption in cancer cell lines .

  • Inflammation: CK2 inhibition stabilizes occludin at TJs, reducing claudin-2 permeability in colitis models .

Production and Availability

Recombinant X. laevis OCLN is commercially available from suppliers like Creative BioMart and Abcam. Key specifications include:

SupplierProduct IDTagExpression SystemApplications
Creative BioMartRFL1932XFHisE. coliSDS-PAGE, ELISA
Abcamab114189NoneWheat germWB, structural studies

Comparative Analysis of Occludin Across Species

SpeciesSequence IdentityKey FeaturesApplications
Xenopus laevis41–58% with mammalsFull-length (1–493 aa), His-tagged, dephosphorylated in early embryos .Developmental studies
HumanFull-length (1–522 aa)S408 phosphorylation regulates ZO-1 binding and TJ stability .Cancer, barrier function
MouseFull-length (1–521 aa)His-tagged; used in knockout models to study TJ integrity .Genetic studies

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate any specific format requirements. Please indicate your preferred format in the order notes, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for precise delivery estimates.
Note: Our standard shipping method includes normal blue ice packs. If dry ice shipping is required, please communicate this to us in advance as additional fees may apply.
Notes
Repeated freezing and thawing should be avoided. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, we recommend briefly centrifuging the vial to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration ranging from 0.1 to 1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquotting the solution. Storage at -20°C or -80°C is advised. Our default glycerol concentration is 50%, which can serve as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquotting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
ocln; Occludin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-493
Protein Length
full length protein
Species
Xenopus laevis (African clawed frog)
Target Names
Target Protein Sequence
MYSRPSNYAPSKDVYGGEMRSQPAYSYYPEEEIQHFYRWSSPPGIIKIMSILIVVMCVGI FACVASTLPWDLDITGQSMGYGMGSGSYSGGYTGYGFGGSQMGLGFAYGGNYTDPRAAKG FILAMAAFCFIIGLVIFVMLVTRTPLSTSRKFYLIVIIVSAIIGGLVFIATIVYTVGVNP VAQASGSAFYTQIVSICNQFYSPVQTGVFVNQYLYHYCVVEPQEAIAIVLGFLIVVAFAI IIFFAVKTRKKINQYGKTNILWKKNHIYEDGDPQVEQWVKNVAENSAPALSDYNEKVDGS VADYRSANGVQAYPSQNNISHPIAEEELPLKEDYGMSPRHYSSSSDATTKKAPPKKRPGK PRRSDLDTNEGGYNTGGESADELEDDSWDSEYPPITQTKQRQEYKQEFASDLHEYKRLQA ELDELSKIPVPSLNRELGQSSRKDSEEYRTVADKYNRLKEIKSSADYRNKKKRCKGLKTK LNHIKQMVSNYDK
Uniprot No.

Target Background

Function
Likely plays a role in the formation and regulation of the tight junction (TJ) paracellular permeability barrier.
Database Links

KEGG: xla:398133

UniGene: Xl.544

Protein Families
ELL/occludin family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, tight junction.
Tissue Specificity
Localized at tight junctions of both epithelial and endothelial cells.

Q&A

What is Xenopus laevis occludin and what is its role in tight junctions?

Xenopus laevis occludin is a protein component of the membrane domain of tight junctions. Its sequence shows homology with occludins from other species, with identities ranging from 41% to 58% . Functionally, occludin plays a crucial role in the assembly and maintenance of epithelial tight junctions, which are essential for epithelial barrier function. Expression of occludin in Xenopus eggs or fibroblasts confers adhesive properties to these cells and results in the formation of primitive tight junction strands . When C-terminally truncated occludin is expressed in Xenopus embryo cells, it increases paracellular permeability, demonstrating its importance in junction integrity .

How is Xenopus laevis occludin structurally organized?

Xenopus laevis occludin is a transmembrane protein with multiple functional domains. The C-terminal cytoplasmic region (domain E, amino acids 247-493) is particularly important for its function . This region contains key phosphorylation sites that regulate occludin activity. The complete cDNA sequence has been isolated and characterized, revealing the full protein structure . Occludin's membrane topology includes four transmembrane domains with two extracellular loops that participate in homotypic interactions between adjacent cells. The protein's structure enables it to form oligomers during tight junction assembly, which is critical for proper barrier function .

Where is occludin expressed in Xenopus laevis tissues?

Occludin mRNA is widely expressed throughout Xenopus tissues, with particularly high abundance in organs involved in regulating salt and water balance. These include the gastrointestinal tract, kidney, and urinary bladder . Within the gastrointestinal tract, occludin mRNA expression increases along the longitudinal axis of the gut. In kidney tissue, occludin shows differential expression within the nephron, appearing predominantly in the distal tubules and collecting ducts on the luminal side . Immunohistochemical analyses have revealed strong occludin immunolabeling in the apicolateral region of epithelia lining the gastrointestinal tract .

What are the methods for isolating and producing recombinant Xenopus laevis occludin?

To isolate and produce recombinant Xenopus laevis occludin, researchers have successfully employed bacterial expression systems. The cytoplasmic domain (domain E, amino acids 247-493) can be expressed as a recombinant protein in bacteria . For specific protein interaction studies, Glutathione S-transferase (GST) fusion constructs with the C-terminal region of Xenopus laevis occludin have been developed .

Methodology generally involves:

  • Isolation of complete Xenopus laevis occludin cDNA

  • Cloning into appropriate expression vectors (such as pGEX for GST fusion proteins)

  • Transformation into bacterial expression systems

  • Induction of protein expression

  • Purification of the recombinant protein using affinity chromatography

For studies requiring detection of the recombinant protein, FLAG-tagging at the COOH terminus has been used to discriminate exogenous from endogenous molecules .

How can researchers detect and visualize Xenopus occludin in experimental systems?

Multiple complementary techniques have been developed for detecting Xenopus occludin:

Immunoblotting analysis: Xenopus laevis occludin has been identified as a 57-61 kDa antigen in embryos using immunoblot analysis with cross-reacting antisera . For membrane proteins, extraction with solutions containing 0.1% Triton X-100 and 1% NP40 has been effective .

Immunofluorescence microscopy: This technique has been successful for visualizing occludin localization in tissues. Using specific antibodies, researchers have shown occludin colocalization with other tight junction proteins like cingulin in epithelial junctions . For recombinant occludin expressed in Xenopus oocytes, confocal microscopy with a pinhole to block out-of-focus fluorescence provides precise localization of the expressed protein in the plasma membrane .

Immunoprecipitation: This method has been used to isolate occludin and identify its binding partners. Under non-denaturing conditions, it can demonstrate the formation of oligomeric complexes between exogenous and endogenous occludin molecules .

What in vitro kinase assays are recommended for studying occludin phosphorylation?

For studying occludin phosphorylation, the following methodological approach has proven effective:

  • Express the cytoplasmic domain of occludin (domain E, amino acids 247-493) as a recombinant protein

  • Perform in vitro kinase assays with purified kinases including protein kinase CK2, CK1, protein kinase A, cdc2 kinase, MAP kinase, and syk kinase

  • Analyze phosphorylation efficiency by measuring stoichiometry and Km values

Research has shown that domain E of Xenopus occludin serves as an excellent substrate for protein kinase CK2 (with a stoichiometry of 10.8% and Km of 8.4 μM) but is not significantly phosphorylated by CK1 kinase, protein kinase A, cdc2 kinase, MAP kinase, or syk tyrosine kinase . To identify specific phosphorylation sites, sequence analysis followed by site-directed mutagenesis of candidate residues (such as Thr375 and Ser379) and subsequent kinase assays with the mutant proteins can be performed .

What is known about the phosphorylation states of occludin during Xenopus development?

The phosphorylation state of occludin changes dynamically during Xenopus development, with significant implications for tight junction assembly:

Developmental pattern: Maternal occludin in unfertilized eggs migrates as a 61 kDa protein in SDS-PAGE. Following fertilization and through early cleavages up to blastula stage 8, it appears as a series of polypeptides with 57-60 kDa. In later developmental stages (gastrulae, neurulae, and tailbud stage embryos), occludin migrates as a 57 kDa polypeptide .

Phosphorylation evidence: The electrophoretic mobility downshift observed during development can be specifically reproduced by treating protein extracts with acid phosphatase, confirming that the mobility change is due to dephosphorylation . This correlation between occludin dephosphorylation and de novo assembly of tight junctions in native epithelia of Xenopus embryos suggests a potential role for occludin dephosphorylation in tight junction assembly .

Which kinases are involved in occludin phosphorylation and what sites do they target?

Several kinases have been identified that can phosphorylate Xenopus occludin, with specific target sites:

Primary kinases:

  • Protein kinase CK2: Phosphorylates the cytoplasmic domain of occludin on serine and threonine residues

  • p34cdc2/cyclin B complex: Can also phosphorylate occludin on serine and threonine residues

Ineffective kinases: Mitogen-activated protein kinase, protein kinase CK1, and p38Syk tyrosine kinase do not significantly phosphorylate occludin .

Target sites: Specific residues Thr375 and Ser379 in domain E have been identified as potential CK2 phosphorylation sites based on sequence analysis . Mutation studies have confirmed their importance:

  • Mutation of Ser379 to aspartic acid or alanine reduces phosphorylation by CK2 by approximately 50%

  • Double mutation of Ser379 and Thr375 to aspartic acid essentially abolishes phosphorylation

How does occludin phosphorylation affect tight junction assembly and function?

The phosphorylation state of occludin plays a critical role in regulating tight junction assembly and barrier function:

  • Developmental correlation: The correlation between occludin dephosphorylation and de novo assembly of tight junctions in Xenopus embryos suggests that dephosphorylation may be important for junction formation .

  • Barrier function: The phosphorylation state affects the paracellular barrier properties of tight junctions. Expression of C-terminally truncated occludin (which lacks key phosphorylation sites) increases paracellular permeability in Xenopus embryo cells .

  • Protein interactions: Phosphorylation may regulate occludin's ability to interact with other tight junction proteins. The C-terminal region, which contains the phosphorylation sites, interacts directly with cingulin, a cytoplasmic plaque component of tight junctions .

  • Oligomerization: Phosphorylation may influence occludin's ability to form oligomers, which is essential for proper tight junction assembly. Immunoprecipitation analysis has shown that occludin oligomerizes during tight junction assembly .

How does occludin interact with cingulin and other tight junction proteins?

Occludin engages in specific interactions with other tight junction components, particularly cingulin:

Occludin-cingulin interaction:

  • GST pull-down experiments using extracts of Xenopus A6 epithelial cells have demonstrated that the C-terminal region of Xenopus laevis occludin associates with several polypeptides, including cingulin .

  • Using in vitro translated, full-length Xenopus cingulin, direct interaction with the C-terminal region of occludin has been confirmed .

  • Immunohistochemical analyses have shown colocalization of occludin with cingulin in epithelial junctions of embryos .

Methodology for studying interactions:

  • GST fusion proteins containing the C-terminal region of occludin

  • Pull-down assays with cell extracts or in vitro translated proteins

  • Immunoblot analysis of the pulled-down proteins

  • Coimmunoprecipitation under non-denaturing conditions to identify protein complexes

What experimental approaches can be used to study occludin oligomerization?

Occludin forms oligomers during tight junction assembly, which can be studied using the following approaches:

Immunoprecipitation analysis: Under non-denaturing conditions, exogenous and endogenous occludins can be co-immunoprecipitated as oligomeric complexes from detergent-solubilized embryo membranes . This approach has demonstrated that occludin oligomerizes during tight junction assembly.

Xenopus embryo expression system: mRNAs coding for FLAG-tagged occludin constructs can be injected into Xenopus embryos, allowing discrimination between exogenous and endogenous molecules . This system permits the study of occludin oligomerization in an intact organism during epithelial biogenesis.

Mutational analysis: Expression of mutant occludin molecules (e.g., COOH-terminally truncated forms) can help determine which domains are important for oligomerization. Despite targeting to tight junctions, truncated mutants may disrupt junction function, suggesting they interact with endogenous occludin .

How can the Xenopus oocyte system be used for studying occludin function?

The Xenopus laevis oocyte system offers a powerful heterologous expression platform for studying tight junction proteins including occludin:

Advantages of the system:

  • Classic model for transporters and human disease modeling

  • Allows for in-depth analysis of protein interactions and functional contributions to junction seals

  • Large size facilitates microinjection and electrophysiological measurements

Methodology:

  • Expression verification: Successful expression and integration of tight junction proteins into the Xenopus oocyte plasma membrane can be confirmed by immunoblot and immunohistochemical visualization .

  • Localization assessment: Confocal laser scanning microscopy with pinhole blocking allows precise localization of expressed proteins in the plasma membrane .

  • Functional analysis: Novel approaches such as the homophilic protein interaction (HPI) test can be used to challenge interaction within the contact area of clustered Xenopus oocytes .

What are the effects of occludin mutations on tight junction function in Xenopus?

Studies on mutant occludin proteins have revealed significant insights into structure-function relationships:

COOH-terminal truncations:

  • mRNAs coding for a series of COOH-terminally truncated chicken occludin molecules have been expressed in Xenopus embryos .

  • Four of the COOH-terminally truncated mutants caused disruption of the tight junction solute seal, as assessed by a surface biotinylation method .

  • The leakage induced by mutant occludins could be rescued by coinjection with full-length occludin mRNA, indicating a dominant-negative effect of the truncated proteins .

Targeting mechanism:

  • Despite their disruptive effects, truncated occludin mutants targeted correctly to tight junctions .

  • Immunoprecipitation analysis revealed that exogenous occludin bound to endogenous Xenopus occludin in vivo, indicating that mutant occludins target to the tight junction by virtue of their ability to oligomerize with full-length endogenous molecules .

Functional implications:
The studies demonstrate that the COOH terminus of occludin is required for correct assembly of tight junction barrier function, possibly through its phosphorylation sites or interaction with other junction components .

How does environmental salinity affect occludin expression and function in Xenopus?

Occludin plays a role in the adaptation of Xenopus to changes in environmental salinity:

Physiological responses to brackish water (BW) acclimation:

  • Xenopus exhibits significant tissue water loss and salinity-dependent elevations in serum osmolality when acclimated to brackish water conditions (2‰, 5‰, or 10‰ salt water) .

  • Increased serum osmolality results from elevated urea levels followed by increased serum Na+ and Cl- levels .

Tissue-specific alterations:

  • Acclimation to brackish water causes tissue-specific and salinity-dependent alterations in occludin mRNA expression within select Xenopus osmoregulatory organs .

  • These changes occur in conjunction with alterations in the ionomotive enzyme Na+,K+-ATPase. Most notably, Na+,K+-ATPase activity in the rectum increases in response to elevated environmental salt concentrations while renal activity decreases .

Functional significance:

  • The alterations in occludin expression, in conjunction with active transport processes, may contribute to amphibian hydromineral homeostasis during environmental change .

  • This suggests that tight junction proteins like occludin are not just static barrier components but dynamically regulated elements that participate in adaptive physiological responses.

How does Xenopus laevis occludin compare structurally and functionally to mammalian homologs?

Xenopus laevis occludin shares significant structural and functional similarities with mammalian homologs, but also displays some species-specific differences:

Sequence homology:

  • The sequence of Xenopus occludin shows homology with occludins from other species, with identities ranging from 41% to 58% .

  • The most conserved regions typically include the transmembrane domains and specific functional motifs in the cytoplasmic domains.

Functional conservation:

  • Like its mammalian counterparts, Xenopus occludin is a component of tight junctions and plays a role in regulating paracellular permeability .

  • The C-terminal domain is critical for tight junction barrier function in both Xenopus and mammalian systems .

  • Phosphorylation appears to regulate occludin function across species, though specific kinases and phosphorylation sites may vary .

Unique features:

  • The developmental regulation of occludin phosphorylation during early Xenopus development represents a system for studying the relationship between phosphorylation state and de novo tight junction assembly .

  • Xenopus occludin contains a motif matching the activation loop of the cytoplasmic domain of insulin receptor kinase, which may suggest species-specific regulatory mechanisms .

What insights has Xenopus occludin research provided for understanding tight junction biology?

Research on Xenopus occludin has contributed several key insights to our understanding of tight junction biology:

  • Developmental assembly: The Xenopus embryo system has provided a valuable model for studying de novo tight junction assembly during epithelial biogenesis in an intact organism .

  • Phosphorylation regulation: The correlation between occludin dephosphorylation and tight junction assembly in Xenopus embryos has highlighted the importance of phosphorylation state in regulating junction formation .

  • Oligomerization: Studies in Xenopus embryos have provided evidence that occludin forms oligomers during the normal process of tight junction assembly, a finding that has expanded our understanding of how these junctions are structurally organized .

  • Environmental adaptation: Research on Xenopus has revealed that tight junction proteins like occludin are dynamically regulated in response to environmental challenges such as changes in salinity, suggesting a broader role in physiological adaptation .

  • Protein interactions: Investigations of Xenopus occludin have identified specific interactions with other tight junction components like cingulin, contributing to our understanding of the molecular architecture of these junctional complexes .

What are common challenges in expressing and purifying recombinant Xenopus occludin?

Researchers working with recombinant Xenopus occludin should be aware of several technical challenges:

Expression challenges:

  • Full-length occludin, as a membrane protein with multiple transmembrane domains, can be difficult to express in soluble form.

  • Most successful approaches have focused on expressing the cytoplasmic domain (domain E, amino acids 247-493) rather than the full-length protein .

  • Using GST fusion constructs can improve solubility and facilitate purification .

Purification considerations:

  • When extracting native occludin from Xenopus tissues, complete extraction requires solutions containing 0.1% Triton X-100 and 1% NP40 .

  • For detection and discrimination from endogenous proteins, epitope tagging (such as FLAG-tagging) at the COOH terminus has proven effective .

Functional assessment:

  • When expressing recombinant occludin in heterologous systems like Xenopus oocytes, verification of proper membrane integration is crucial and can be accomplished through immunohistochemical visualization and confocal microscopy .

How can researchers optimize phosphorylation studies of Xenopus occludin?

For effective phosphorylation studies of Xenopus occludin, consider the following methodological optimizations:

Kinase selection:

  • Focus on protein kinase CK2 and p34cdc2/cyclin B complex, which have been identified as effective occludin kinases .

  • Other kinases including mitogen-activated protein kinase, protein kinase CK1, and p38Syk tyrosine kinase are less likely to yield significant phosphorylation .

Substrate preparation:

  • Use bacterially expressed domain E of Xenopus occludin (amino acids 247-493) as a substrate for in vitro kinase assays .

  • For site-specific studies, prepare mutant constructs with alterations at potential phosphorylation sites (particularly Thr375 and Ser379) .

Assay conditions:

  • When assessing CK2 phosphorylation, optimal conditions yield a stoichiometry of approximately 10.8% and Km of 8.4 μM .

  • For comparing phosphorylation states of native occludin, electrophoretic mobility shifts provide a useful indicator, with phosphorylated forms migrating at 60-61 kDa and dephosphorylated forms at 57 kDa .

Validation approaches:

  • Confirm phosphorylation status changes using phosphatase treatment of protein extracts and observing electrophoretic mobility shifts .

  • For in vivo studies, correlate phosphorylation states with developmental stages or physiological conditions .

What control experiments are essential when studying occludin function in Xenopus systems?

When investigating occludin function in Xenopus systems, several control experiments are critical:

Expression controls:

  • Water-injected or vector-only controls should be used when expressing recombinant occludin in Xenopus oocytes or embryos .

  • Immunoblot and immunohistochemical verification of expression and proper localization are essential before functional assessments .

Rescue experiments:

  • When expressing mutant occludin constructs that disrupt tight junction function, co-injection with full-length occludin mRNA can serve as a rescue control to verify specificity of the observed phenotype .

Antibody specificity:

  • When using antibodies for detection or immunoprecipitation, verify cross-reactivity with Xenopus occludin, as many commercially available antibodies are raised against mammalian proteins .

Functional assessments:

  • For barrier function studies, include both positive controls (known barrier disruptors) and negative controls (non-junction-affecting treatments) to validate assay sensitivity and specificity .

  • When studying tight junction formation in embryos, carefully correlate occludin localization with other tight junction markers like cingulin .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.