Recombinant Xenopus laevis Oligosaccharyltransferase complex subunit ostc-A (ostc-a)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Xenopus laevis Oligosaccharyltransferase Complex Subunit Ostc-A (Ostc-A) is a protein component of the oligosaccharyltransferase (OST) complex in the African clawed frog (Xenopus laevis) . The OST complex is a multi-subunit enzyme that catalyzes N-glycosylation, a crucial post-translational modification in eukaryotes . N-glycosylation is essential for protein folding, quality control, trafficking, signal transduction, and cell-to-cell communication .

Function of the OST Complex

The OST complex transfers a glycan from a dolichol pyrophosphate donor to an asparagine residue within the Asn-X-Ser/Thr consensus motif of nascent polypeptide chains in the endoplasmic reticulum (ER) . This process occurs co-translationally, where the OST complex associates with the Sec61 complex at the translocon channel to mediate protein translocation across the ER membrane .

Subunits and Isoforms of the OST Complex

In mammalian cells, there are two distinct OST complexes, STT3A-OST and STT3B-OST, which contain either STT3A or STT3B as their catalytic subunits, along with several accessory proteins . These accessory proteins include common subunits such as RPN1, RPN2, OST48/DDOST, OST4, TMEM258, and DAD1, as well as subunits specific to either STT3A-OST (DC2/OSTC and KCP2) or STT3B-OST (TUSC3 and MAGT1) . Xenopus laevis Ostc-A is a specific component of the STT3A-containing OST complex .

Role of Ostc-A

OSTC/DC2, including Xenopus laevis Ostc-A, is specific to STT3A-OST and found only in vertebrates . While not required for the enzymatic activity of STT3A-OST, OSTC/DC2 is necessary for the association with the Sec61 channel and co-translational N-glycosylation . It has been located at the interface between STT3A and Sec61, bridging the protein-conducting channel and glycosylation machinery .

Importance of OST Subunits

The accessory subunits of the OST complex, such as OST48 and DAD1, play a significant role in stabilizing both STT3A- and STT3B-containing OST complexes . Depletion of these subunits can lead to severe reduction in OST complex formation . KCP2, another STT3A-OST-specific subunit, also influences protein N-glycosylation in a substrate-specific manner .

Disease Associations and Implications

Given the crucial roles of N-glycosylation, deficiencies in genes encoding OST subunits can result in complex genetic disorders . Furthermore, the expression of OST subunits is often altered in malignant cells, contributing to tumor cell survival and proliferation . This makes OST a potential target for cancer treatment .

Expression and Characteristics

Recombinant Xenopus laevis Oligosaccharyltransferase complex subunit ostc-A (ostc-a) can be produced in vitro using an E. coli expression system .

Table 1: OST Subunits and Their Functions

SubunitFunctionComplex Association
STT3ACatalytic subunitSTT3A-OST
STT3BCatalytic subunitSTT3B-OST
RPN1Accessory proteinBoth STT3A-OST and STT3B-OST
RPN2Accessory proteinBoth STT3A-OST and STT3B-OST
OST48/DDOSTAccessory proteinBoth STT3A-OST and STT3B-OST
OST4Accessory proteinBoth STT3A-OST and STT3B-OST
TMEM258Accessory proteinBoth STT3A-OST and STT3B-OST
DAD1Accessory proteinBoth STT3A-OST and STT3B-OST
DC2/OSTCSec61 channel associationSTT3A-OST
KCP2N-glycosylation influenceSTT3A-OST
TUSC3Specific subunitSTT3B-OST
MAGT1Specific subunitSTT3B-OST

Table 2: Effects of OST Subunit Depletion

Depleted SubunitObserved Effect
OST48Destabilization of both STT3A- and STT3B-containing OST complexes
DAD1Destabilization of both STT3A- and STT3B-containing OST complexes
KCP2Mobility shift of the major STT3A-containing complex

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ostc-a; Oligosaccharyltransferase complex subunit ostc-A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-149
Protein Length
full length protein
Species
Xenopus laevis (African clawed frog)
Target Names
ostc-a
Target Protein Sequence
MESLYRVPFTVLECPNLKLKKPSWLHMPSAMTVYAMVVVSYFLITGGIIYDVIVEPPSVG SMTDEHGHQRPVAFLAYRVNGQYIMEGLASSFLFTMGGLGFIILDRSNTPNIPKLNRFLL LFIGFVCVLLSFFMARVFMRMKLPGYLMG
Uniprot No.

Target Background

Function

This protein is a subunit of the oligosaccharyltransferase (OST) complex. The OST complex catalyzes the transfer of a defined glycan (Glc3Man9GlcNAc2 in eukaryotes) from the lipid carrier dolichol-pyrophosphate to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains. This is the initial step in protein N-glycosylation. N-glycosylation occurs co-translationally, and the complex interacts with the Sec61 complex at the translocon, facilitating protein translocation across the endoplasmic reticulum (ER). All subunits are essential for optimal enzyme activity.

Database Links

KEGG: xla:444229

UniGene: Xl.53498

Protein Families
OSTC family
Subcellular Location
Membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.