Recombinant Xenopus laevis Oligosaccharyltransferase complex subunit ostc-B (ostc-b)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ostc-b; Oligosaccharyltransferase complex subunit ostc-B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-149
Protein Length
full length protein
Species
Xenopus laevis (African clawed frog)
Target Names
ostc-b
Target Protein Sequence
MESLYRIPFTVLECPNLKLKKPSWLHMPSAMTVYAMVVVSYFLITGGIIYDVIVEPPSVG SMTDEHGHQRPVAFLAYRVNGQYIMEGLASSFLFTMGGLGFIILDRSNAPNIPKLNRFLL LFIGFVCVLLSFFMARVFMRMKLPGYLMG
Uniprot No.

Target Background

Function

A subunit of the oligosaccharyltransferase (OST) complex. This complex catalyzes the initial transfer of a defined glycan (Glc3Man9GlcNAc2 in eukaryotes) from the lipid carrier dolichol-pyrophosphate to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains. This is the first step in protein N-glycosylation. N-glycosylation occurs co-translationally, and the OST complex associates with the Sec61 complex at the translocon, mediating protein translocation across the endoplasmic reticulum (ER). All subunits are essential for optimal enzyme activity.

Database Links

KEGG: xla:496140

UniGene: Xl.15624

Protein Families
OSTC family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the Xenopus laevis Oligosaccharyltransferase complex and why study the OSTC-B subunit?

Oligosaccharyltransferase (OST) is a critical enzyme complex responsible for N-linked glycosylation, one of the most common protein modification reactions in eukaryotic cells that occurs on the majority of proteins entering the secretory pathway . The OST complex catalyzes the transfer of oligosaccharides to asparagine residues on nascent polypeptides.

The OSTC-B subunit is one component of the multisubunit complex in Xenopus laevis. Studying this specific subunit is valuable because:

Research on OST subunits has been facilitated by recent structural studies using cryo-electron microscopy that revealed the organization of multisubunit OSTs, including an octameric complex in yeast and mammalian OST complexes interacting with the protein translocation channel and translating ribosomes .

How does X. laevis compare to X. tropicalis as a model system for studying OST complex proteins?

While both Xenopus species serve as valuable model organisms, they offer distinct advantages for studying OST complex proteins:

Xenopus laevis advantages:

  • Produces larger eggs and embryos, yielding about five-fold more material per embryo for biochemical work

  • Has more established cell-free systems that are reliable for biochemical and cell biological analysis

  • Provides greater amounts of proteins for structural studies

Xenopus tropicalis advantages:

  • Possesses a diploid genome (unlike the allotetraploid X. laevis), making genetic studies more straightforward

  • Has a shorter generation time (less than a year compared to over a year for X. laevis)

  • Enables more straightforward genetic manipulation and screening

  • Benefits from more complete genomic resources

What are the key structural features of the OST complex that OSTC-B contributes to?

Based on structural studies of OST complexes from various organisms, we can infer information about the potential role of OSTC-B:

The OST complex functions in the transfer of oligosaccharides to specific asparagine residues in target proteins. X-ray crystallography of single-subunit OSTs from prokaryotic organisms has revealed donor and acceptor substrate binding sites that form the basis for the catalytic mechanism . In eukaryotes like Xenopus, the complex is more elaborate, with multiple subunits.

OSTC-B likely contributes to:

  • Maintaining structural integrity of the multisubunit complex

  • Potentially participating in substrate recognition or specificity

  • Facilitating interactions with other cellular components involved in the secretory pathway

Cryo-electron microscopy studies of octameric yeast OST and mammalian OST complexes have provided substantial insights into the organization and assembly of multisubunit oligosaccharyltransferases . These structures show how the complex associates with the protein translocation channel and translating ribosomes during cotranslational glycosylation, suggesting OSTC-B may play a role in this coordinated process.

What strategies can be employed to express and purify active recombinant X. laevis OSTC-B for structural studies?

Expressing and purifying active recombinant X. laevis OSTC-B requires careful consideration of expression systems, purification strategies, and activity preservation:

Expression systems options:

Expression SystemAdvantagesLimitations
E. coliHigh yield, economical, simple cultureLacks eukaryotic post-translational modifications, potential for improper folding
Insect cellsBetter protein folding, some post-translational modificationsMore complex culture conditions, moderate yield
X. laevis oocytesNative environment, ideal for expression chamber approachLabor-intensive, lower yield
Mammalian cellsFull post-translational modifications, proper foldingExpensive, complex culture conditions

The X. laevis oocyte system has historically been valuable as an "expression chamber" for identifying channels and transporters, which could be adapted for OSTC-B studies . For structural studies requiring larger amounts of protein, insect or mammalian cell systems may be preferable.

Purification considerations:

  • Use affinity tags that don't interfere with OSTC-B function

  • Consider detergent selection if OSTC-B has membrane-associated regions

  • Maintain complex integrity if OSTC-B function depends on interactions with other OST subunits

  • Assess protein activity through glycosylation assays at each purification step

The development of full-length cDNA libraries and the Xenopus ORFeome project have generated resources flexibly designed for expression screening and proteomic applications , which may facilitate recombinant OSTC-B production.

How can researchers address the challenges of the allotetraploid X. laevis genome when studying OSTC-B function?

The allotetraploid nature of the X. laevis genome presents unique challenges for studying OSTC-B function due to potential gene duplications. Researchers can address these challenges through several approaches:

  • Genome-informed design: With the availability of high-quality X. laevis genome assemblies, researchers can accurately design tools that target specific alloalleles of OSTC-B. This allows for precise morpholino oligonucleotides that target translation starts or splice junctions of both alloalleles .

  • Comparative genomics approach: Comparing OSTC-B sequences between X. laevis and X. tropicalis can help identify conserved functional domains versus regions that may have diverged after genome duplication.

  • Differential knockdown strategies:

    • Targeting shared sequences to affect all OSTC-B variants

    • Selectively targeting specific variants to assess their individual contributions

    • Employing titrated knockdowns to evaluate dose-dependent effects

  • Proteomics verification: Using mass spectrometry coupled with genome data to verify which OSTC-B variants are actually expressed in different tissues or developmental stages .

  • Complementation studies: Testing whether OSTC-B from X. tropicalis can rescue phenotypes in X. laevis when endogenous OSTC-B is knocked down.

The substantial sequence differences between duplicated alloalleles in X. laevis may actually facilitate the specific targeting of OSTC-B variants, turning a potential challenge into an experimental advantage.

What methods are optimal for analyzing OSTC-B integration into the full OST complex in X. laevis systems?

Analyzing OSTC-B integration into the complete OST complex requires methods that preserve complex integrity while providing insights into subunit interactions:

Blue Native PAGE and Complex Fractionation:
This technique allows separation of intact protein complexes and can be used to determine if OSTC-B is properly incorporated into the OST complex. Subsequent western blotting or mass spectrometry can identify associated proteins.

Proximity Labeling Approaches:
Techniques such as BioID or APEX2 fusion proteins can identify proteins in close proximity to OSTC-B within the native cellular environment, revealing direct interaction partners within the OST complex.

Co-immunoprecipitation with Structural Analysis:
Leveraging the advantages of X. laevis for biochemical work, researchers can isolate sufficient material for co-immunoprecipitation followed by structural analysis. Recent advances in cryo-EM have revealed the structure of OST complexes from yeast and mammals , and similar approaches could be applied to X. laevis OST with a focus on OSTC-B positioning.

Fluorescence Resonance Energy Transfer (FRET):
By tagging OSTC-B and other OST components with appropriate fluorophores, researchers can monitor complex assembly in real-time within living X. laevis oocytes or embryonic cells.

Cross-linking Mass Spectrometry:
This technique involves chemical cross-linking of proteins within the complex followed by mass spectrometry analysis to map interaction sites, providing detailed information about OSTC-B's position and contacts within the OST complex.

How can X. laevis embryos be utilized to study developmental regulation of OSTC-B expression?

X. laevis embryos offer an excellent system for studying developmental regulation of OSTC-B expression due to their external development, large size, and ease of manipulation:

In situ hybridization approaches:
Using stage-specific embryos, researchers can track OSTC-B mRNA expression patterns throughout development. The large size of X. laevis embryos facilitates precise spatial resolution of expression domains. By combining fluorescent in situ hybridization with immunostaining for OST complex components, researchers can correlate mRNA and protein localization.

Reporter gene constructs:
The OSTC-B promoter region can be cloned upstream of reporter genes like GFP and injected into X. laevis embryos to monitor transcriptional activity in various tissues and developmental stages. This approach can identify enhancers and repressors affecting OSTC-B expression.

Tissue-specific analysis:
X. laevis embryos can be dissected into specific regions (using techniques demonstrated in Fig. 4.3 of reference ) to examine regional differences in OSTC-B expression. This is particularly valuable when studying how OSTC-B contributes to tissue-specific glycosylation patterns.

Temporal regulation studies:
X. laevis produces synchronously developing embryos in large numbers, allowing for precise temporal analysis of OSTC-B expression through developmental stages. Researchers can collect samples at precise timepoints to generate detailed expression profiles using RT-qPCR or RNA-seq.

Epigenetic regulation:
As noted in reference , the genomic information from X. laevis provides valuable resources for studying epigenetic changes in gene activity during development, which could be applied to understanding OSTC-B regulation.

What approaches can be used to analyze functional differences between OSTC-B variants resulting from the allotetraploid nature of X. laevis?

The allotetraploid genome of X. laevis likely results in OSTC-B variants that may have distinct or overlapping functions. Several approaches can be employed to analyze these functional differences:

Variant-specific gene editing:
With the X. laevis genome now available, CRISPR/Cas9 targeting can be designed for specific OSTC-B variants. Researchers can generate knockout or knockin lines for individual variants to assess their unique contributions to OST function.

Rescue experiments with variant specificity:
In embryos where endogenous OSTC-B has been knocked down, researchers can introduce mRNAs encoding specific variants to determine which can rescue normal glycosylation patterns. This approach can be quantified by measuring substrate glycosylation efficiency.

Biochemical activity comparisons:
Recombinant production of different OSTC-B variants allows direct comparison of their biochemical properties:

PropertyMethod of AssessmentExpected Differences
Binding affinity to OST componentsSurface plasmon resonanceMay reveal specialized roles in complex assembly
Substrate specificityGlycosylation assays with varied peptide substratesCould identify variant-specific preferences
Thermal stabilityDifferential scanning fluorimetryMight indicate evolutionary adaptations
Post-translational modificationsMass spectrometryCould reveal regulatory differences

Tissue-specific expression analysis:
RT-qPCR or RNA-seq with variant-specific primers can determine if OSTC-B variants show differential expression across tissues, suggesting specialized functions.

Evolutionary rate analysis:
Comparing substitution rates between OSTC-B variants can reveal if one copy is evolving under different selective pressures, indicating functional divergence after genome duplication.

How can researchers reconcile contradictory data on OSTC-B function between in vitro biochemical assays and in vivo developmental studies?

Researchers often encounter discrepancies between in vitro biochemical data and in vivo developmental findings when studying proteins like OSTC-B. Several strategies can help reconcile such contradictions:

Context-dependent function assessment:
OSTC-B may function differently depending on cellular context. Using the X. laevis system allows for both approaches:

  • In vitro: Cell-free extracts from X. laevis eggs provide a biochemically tractable system

  • In vivo: The same extracts can be supplemented with membranes to reconstitute more complete cellular contexts

Developmental timing considerations:
Apparent contradictions may result from temporal dynamics of OSTC-B function. X. laevis embryos can be precisely staged and sampled to create temporal activity profiles, revealing stage-specific functions that might explain discrepancies.

Compensatory mechanism identification:
In vivo systems often have redundancy and compensation not present in vitro. The self-adjusting mechanisms observed in X. laevis embryonic development suggest similar processes might mask OSTC-B functional requirements in vivo. Researchers can:

  • Test combined knockdowns of OSTC-B and potential compensatory factors

  • Use rapid protein degradation systems to bypass developmental compensation

  • Perform transcriptome analysis to identify upregulated genes after OSTC-B loss

Integration of multiple approaches:
Combining methodologies can provide a more complete picture:

ApproachStrengthsLimitationsIntegration Strategy
In vitro biochemistryPrecise mechanistic insightsLacks cellular contextIdentify catalytic parameters to validate in vivo
Cell cultureControlled environmentMay not reflect developmental complexityBridge between biochemistry and embryology
Embryo microinjectionDevelopmental contextComplex system with many variablesTarget specific tissues or developmental stages
Explant culturesSimplified in vivo environmentLimited to specific tissuesTest biochemical findings in semi-in vivo context

What are the optimal conditions for expressing recombinant X. laevis OSTC-B in different systems?

Optimal expression of recombinant X. laevis OSTC-B varies depending on the expression system chosen. Here are specific considerations for different systems:

X. laevis Oocyte Expression System:
This system offers a native-like environment particularly suited for functional studies:

  • Microinject 5-25 ng of capped OSTC-B mRNA into stage V-VI oocytes

  • Incubate at 18°C for 48-72 hours in modified Barth's solution

  • For membrane proteins like OSTC-B, ensure proper targeting by including appropriate signal sequences

  • The X. laevis oocyte has historically been successful as an expression chamber for identifying novel channels and transporters

Insect Cell Expression:

  • Clone OSTC-B into baculovirus vectors with appropriate tags

  • Optimal infection at MOI of 2-5 for Sf9 or High Five cells

  • Expression at 27°C for 48-72 hours typically yields best results

  • Include N-terminal signal sequence and consider codon optimization

Mammalian Cell Expression:

  • HEK293 or CHO cells are recommended due to their glycosylation machinery

  • Transient transfection using lipofection or PEI for smaller scale studies

  • Stable cell line generation for larger-scale production

  • Culture at 37°C with 5% CO2, but reducing to 30-32°C after induction can improve folding

E. coli Expression (for domains lacking glycosylation):

  • Use specialized strains like Rosetta or SHuffle for eukaryotic proteins

  • Induce at lower temperatures (16-20°C) to improve folding

  • Include solubility tags such as MBP or SUMO

  • Consider co-expression with chaperones to improve folding

For all systems, codon optimization based on the X. laevis sequence bias can improve expression yields. The availability of X. laevis cDNA libraries and the ORFeome project provides excellent starting material for cloning OSTC-B .

What methods are most effective for analyzing OSTC-B's role in N-glycosylation within X. laevis embryonic systems?

To analyze OSTC-B's role in N-glycosylation within X. laevis embryonic systems, researchers can employ several complementary approaches:

Morpholino Knockdown with Glycoprotein Analysis:

  • Design morpholinos targeting both alloalleles of OSTC-B based on X. laevis genome data

  • Inject morpholinos at the 1-2 cell stage (2-20 ng)

  • Harvest embryos at desired stages and analyze glycoproteins by:

    • SDS-PAGE with glycoprotein-specific stains

    • Lectin blotting to detect specific glycan structures

    • Mass spectrometry-based glycoproteomics

Glycosylation Reporter Assays:

  • Generate constructs with known N-glycosylation sites fused to easily detectable reporters

  • Co-inject with OSTC-B morpholinos or overexpression constructs

  • Analyze shifts in reporter molecular weight to assess glycosylation efficiency

Cell Type-Specific Analysis:
X. laevis embryos have distinct cell populations that can be analyzed separately:

  • Exploit the natural D-V and A-P axes of X. laevis embryos to study regional differences

  • Use tissue-specific promoters to drive OSTC-B variants in specific lineages

  • Perform manual dissection of different regions (as shown in Figure 4.3 ) to analyze region-specific glycosylation patterns

Quantitative Glycoproteomics:

  • Develop a glycopeptide enrichment strategy optimized for X. laevis samples

  • Use stable isotope labeling to compare glycopeptide abundance in control vs. OSTC-B-depleted embryos

  • Map glycosylation sites using ETD or EThcD fragmentation

In vitro Translation-Glycosylation Assay:

  • Prepare X. laevis egg extracts with or without OSTC-B immunodepletion

  • Add membranes containing the OST complex

  • Measure glycosylation of model substrates in real-time

The large size and abundant material from X. laevis embryos make them particularly well-suited for biochemical analysis of glycosylation compared to other model systems .

What purification strategy yields the highest activity retention for recombinant X. laevis OSTC-B?

Purifying recombinant OSTC-B with preserved activity requires a carefully optimized strategy that maintains the protein's native conformation and functional capacity:

Initial Extraction Considerations:

  • Use mild detergents like digitonin (0.5-1%) or DDM (0.5-1%) for membrane extraction

  • Include glycerol (10-15%) to stabilize protein structure during purification

  • Maintain physiologically relevant pH (7.2-7.6) throughout the process

  • Add protease inhibitors and low concentrations of reducing agents

Multi-step Purification Strategy:

Purification StepDetailsCritical Parameters
Affinity ChromatographyHIS-tag or FLAG-tag for initial captureLow imidazole in wash buffers to reduce non-specific binding
Ion ExchangeSeparate OSTC-B from remaining contaminantsDetermine optimal pH based on theoretical pI of X. laevis OSTC-B
Size ExclusionIsolate properly folded monomeric OSTC-BCritical for removing aggregates that lower specific activity
Optional: Lipid NanodiscsReconstitute in membrane-like environmentPreserves activity for membrane-associated regions

Activity Preservation Measures:

  • Perform all purification steps at 4°C

  • Include stabilizing ligands if known

  • Avoid freeze-thaw cycles; instead, aliquot and flash-freeze samples

  • Test activity at each purification stage to identify problematic steps

Quality Control:

  • Circular dichroism to confirm proper secondary structure

  • Thermal shift assays to identify stabilizing buffer conditions

  • Activity assays using simplified glycosylation substrates

  • Mass spectrometry to confirm post-translational modifications

For complex formation studies, consider co-expression with other OST subunits, which may significantly enhance stability and activity. The X. laevis system allows for co-expression of multiple components, and recent structural studies of OST complexes provide valuable guidance for designing constructs that maintain proper subunit interactions.

How can insights from X. laevis OSTC-B research be translated to understanding human N-glycosylation disorders?

Research on X. laevis OSTC-B provides valuable insights that can be translated to understanding human N-glycosylation disorders through several avenues:

Evolutionary Conservation Analysis:
The fundamental mechanisms of N-glycosylation are highly conserved across species. Comparative studies between X. laevis OSTC-B and human orthologs can identify:

  • Core functional domains essential across species

  • Species-specific adaptations that might inform human disease variants

  • Conserved regulatory mechanisms controlling OST complex assembly

Disease Variant Modeling:
X. laevis embryos provide an excellent system for modeling human disease variants:

  • Human OSTC-B disease variants can be expressed in X. laevis embryos after knockdown of endogenous OSTC-B

  • The resulting glycosylation patterns can be analyzed using the abundant material available from X. laevis

  • Structure-function relationships can be established more readily than in mammalian systems

Therapeutic Strategy Development:
Understanding fundamental mechanisms of OSTC-B function in X. laevis can inform therapeutic approaches:

  • Identification of critical functional domains that could be targeted by stabilizing compounds

  • Discovery of compensatory mechanisms that might be leveraged therapeutically

  • Development of functional assays for screening compounds that modulate OST activity

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.