Recombinant Xenopus laevis Phosphatidylinositide phosphatase SAC1 (sacm1l)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
Note: While the tag type is determined during production, please specify your required tag type for preferential development.
Synonyms
sacm1l; Phosphatidylinositol-3-phosphatase SAC1; Phosphatidylinositol-4-phosphate phosphatase; Suppressor of actin mutations 1-like protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-586
Protein Length
full length protein
Species
Xenopus laevis (African clawed frog)
Target Names
Target Protein Sequence
MALAYENLKLHITPEKFYVEACDPGVEDVLTIDRVSTEVTLSGKKDIPPSAITRAIYGIL GTIRLVAGMYLIVITRRKKVGDLLNHSIWKATDFDIISYKKTMLHLTDSQLQDNKAFLGM LSHVLSVDGFYFSVSYDLTHTLQRLANTSPEFQEMSLLERADQRFVWNGNLLREFSAQPE IQKFAIPVVHGFIAIHSCSINGKYFDWILISRRSCFRAGVRYYVRGIDSEGHAANFVETE QIVHYNGNKASFVQTRGSIPFYWSQRPNLKYKPKPQISKAVNHMDGFQRHFDSQVISYGK QVVLNLVNQKGSEKPLEQEFSQMVSGLGNGMVRYIAFDFHKECSRMRWDRLQILVEQVAE TQDEFGYFLVDTEGKVVSQQDGIFRSNCMDCLDRTNVVQSLLARRSLQYQLQRLGVLHVG QRIEEQIQFEKIYKNAWADNANACAKQYAGTGALKTDFTRTGKRTQWGLLMDGWNSLIRY YKNNFSDGFRQDSIDLFLGNYSVEEAYSTSPLHIQTDWKFLALPIIMVVAFSMCIICLLM AGDTWTETLAYVLFWGTASIGTGAIIMYNGKDFVDAPKLVQKEKMD
Uniprot No.

Target Background

Function
Phosphatidylinositide phosphatase that catalyzes the hydrolysis of phosphatidylinositol 4-phosphate (PtdIns(4)P) and phosphatidylinositol 3-phosphate (PtdIns(3)P). It exhibits low activity toward phosphatidylinositol-3,5-bisphosphate (PtdIns(3,5)P2).
Database Links

KEGG: xla:444578

UniGene: Xl.45771

Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is Phosphatidylinositide phosphatase SAC1 (sacm1l) and what is its significance in Xenopus laevis?

Phosphatidylinositide phosphatase SAC1 (sacm1l) in Xenopus laevis is a critical enzyme involved in phosphoinositide metabolism. It functions primarily as a phosphatidylinositol-4-phosphate phosphatase and is also known as a suppressor of actin mutations 1-like protein . This enzyme plays a fundamental role in membrane trafficking and lipid signaling pathways that are essential for cellular development and function. In the Xenopus model system, SAC1 is particularly valuable for studying conserved developmental pathways, as Xenopus laevis serves as an excellent vertebrate model for exploring the ontogeny of central neural networks and developmental processes . The full-length protein consists of 586 amino acids and contains several functional domains that facilitate its enzymatic activity and cellular localization.

How should recombinant Xenopus laevis SAC1 protein be stored and handled to maintain optimal activity?

For optimal storage and handling of recombinant Xenopus laevis SAC1 protein, follow these evidence-based guidelines:

  • Short-term storage: Store working aliquots at 4°C for up to one week to maintain protein integrity

  • Long-term storage: Store at -20°C/-80°C upon receipt, with proper aliquoting to avoid repeated freeze-thaw cycles that can degrade the protein

  • Reconstitution protocol:

    • Centrifuge the vial briefly before opening to bring contents to the bottom

    • Reconstitute the lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Add glycerol to a final concentration of 5-50% (recommended 50%) to prevent freeze damage

    • Prepare small aliquots to minimize freeze-thaw cycles

  • Buffer conditions: The protein is typically stored in Tris/PBS-based buffer with 6% Trehalose at pH 8.0, which helps maintain stability

Storage ParameterRecommendationPurpose
Working stock temperature4°CShort-term activity preservation
Long-term storage−20°C/−80°C in aliquotsPrevent protein degradation
Glycerol concentration50%Cryoprotection
Reconstitution concentration0.1-1.0 mg/mLOptimal protein stability
pH8.0Maintain native conformation

Repeated freeze-thaw cycles should be strictly avoided as they significantly reduce enzymatic activity through protein denaturation .

What are the key considerations for designing experimental assays with recombinant Xenopus laevis SAC1?

When designing experimental assays with recombinant Xenopus laevis SAC1, researchers should consider several critical factors:

Enzymatic activity considerations:

  • The optimal temperature for enzymatic assays is typically 25-30°C, reflecting the poikilothermic nature of Xenopus laevis

  • The pH optimum for SAC1 phosphatase activity generally falls between 6.5-7.5

  • Divalent cations (particularly Mg²⁺) are often required as cofactors for phosphatase activity

Substrate selection:

  • Primary substrate specificity is for phosphatidylinositol-4-phosphate (PI4P)

  • Synthetic substrates with fluorescent or colorimetric readouts can be used for high-throughput assays

  • Consider using radiolabeled substrates for highest sensitivity in phosphatase activity measurements

Assay design methodology:

  • Establish proper negative controls using heat-inactivated enzyme

  • Include a phosphatase inhibitor control (e.g., sodium orthovanadate)

  • Develop a standard curve using known phosphate concentrations

  • Ensure the reaction remains in the linear phase for kinetic measurements

  • Validate SAC1 activity by comparing with commercially available phosphatases

The experimental system should incorporate appropriate controls that acknowledge Xenopus laevis as a model organism with unique developmental properties that make it ideal for studying conserved cellular mechanisms .

How does Xenopus laevis SAC1 phosphatase activity compare with orthologs from other species?

Xenopus laevis SAC1 (sacm1l) shares significant homology with mammalian orthologs but exhibits some species-specific characteristics:

SpeciesSequence IdentityKey Functional DifferencesTemperature Optima
Xenopus laevis SAC1ReferenceAdapted for poikilothermic conditions25-30°C
Human SACM1L~70-80%Higher thermal stability37°C
Mouse SACM1L~70-75%Similar to human, with minor differences in regulatory regions37°C
Rat SACM1L~70-75%Slight variations in non-catalytic domains37°C

Comparative analysis reveals that while the catalytic domain is highly conserved across species, the regulatory regions show greater divergence, potentially reflecting adaptation to different cellular environments. These differences should be considered when:

  • Extrapolating findings from Xenopus models to mammalian systems

  • Designing cross-species complementation experiments

  • Developing antibodies or inhibitors targeting specific SAC1 orthologs

  • Interpreting evolutionary conservation of phosphatidylinositide signaling pathways

The amphibian Xenopus laevis has proven to be an excellent model for studying conserved developmental mechanisms across vertebrates, making its SAC1 phosphatase particularly valuable for comparative studies . Researchers should be aware that the protein may have evolved specific adaptations to function optimally in the developmental context of amphibian embryogenesis.

What methods can be used to assess the in vivo function of SAC1 in Xenopus laevis development?

To investigate the in vivo function of SAC1 in Xenopus laevis development, researchers can employ several complementary approaches:

Morpholino-based knockdown:

  • Design antisense morpholinos targeting the translation start site or splice junctions of SAC1 mRNA

  • Inject morpholinos into 1-2 cell stage embryos

  • Analyze developmental phenotypes using time-lapse microscopy

  • Confirm specificity through rescue experiments with morpholino-resistant SAC1 mRNA

CRISPR/Cas9 genome editing:

  • Design guide RNAs targeting conserved regions of the SAC1 gene

  • Inject Cas9 protein and guide RNAs into fertilized eggs

  • Screen F0 "crispants" for phenotypes and confirm mutations by sequencing

  • Establish stable knockout lines through appropriate breeding schemes

Dominant-negative approaches:

  • Generate catalytically inactive SAC1 mutants (e.g., by point mutations in the catalytic domain)

  • Express these constructs in developing embryos to compete with endogenous SAC1

  • Analyze resulting phenotypes for insights into SAC1 function

Transgenic reporter systems:

  • Create fusion proteins between SAC1 and fluorescent tags

  • Generate transgenic Xenopus lines expressing these reporters

  • Perform live imaging to track SAC1 localization during development

Xenopus laevis is particularly amenable to these approaches due to its experimental advantages, including external development, large embryo size, and the ability to perform microinjections . The system allows for semi-intact and isolated preparations that facilitate in vitro morphophysiological experimentation, providing insights into developmental processes that would be challenging to study in other models .

How can recombinant SAC1 protein be used to study phosphoinositide signaling pathways in Xenopus oocytes and embryos?

Recombinant SAC1 protein offers powerful tools for dissecting phosphoinositide signaling pathways in Xenopus systems:

Microinjection experiments:

  • Directly inject purified recombinant SAC1 protein into Xenopus oocytes or embryos

  • Monitor changes in phosphoinositide levels using fluorescent biosensors

  • Observe resulting alterations in developmental processes or cellular responses

  • Compare with effects of catalytically inactive SAC1 mutants as controls

In vitro reconstitution:

  • Use recombinant SAC1 to deplete specific phosphoinositides from isolated membrane fractions

  • Assess how this affects the recruitment and function of phosphoinositide-binding proteins

  • Reconstitute minimal signaling systems with defined components to determine sufficiency

Phosphoinositide interactome analysis:

  • Immobilize recombinant SAC1 on affinity columns

  • Pass Xenopus egg or embryo lysates over these columns

  • Identify interacting proteins by mass spectrometry

  • Validate interactions through co-immunoprecipitation and functional assays

The Xenopus system has made significant contributions to the analysis of RNA genes and offers diverse applications through oocyte injection technology . This makes it particularly suitable for studying phosphoinositide signaling mechanisms, as researchers can exploit the well-established microinjection techniques and the large size of Xenopus oocytes and early embryos to visualize signaling processes with subcellular resolution.

What are the critical quality control parameters for validating recombinant Xenopus laevis SAC1 before experimental use?

Before using recombinant Xenopus laevis SAC1 in experiments, researchers should validate the protein through multiple quality control measures:

Purity assessment:

  • Confirm >90% purity by SDS-PAGE as specified in product documentation

  • Consider additional purification steps if higher purity is required for sensitive assays

  • Analyze by mass spectrometry to verify protein identity and detect potential contaminants

Structural integrity validation:

  • Circular dichroism spectroscopy to assess secondary structure

  • Thermal shift assays to evaluate protein stability

  • Dynamic light scattering to verify monodispersity and absence of aggregation

Functional activity testing:

  • Phosphatase activity assay using a model substrate (e.g., para-nitrophenyl phosphate)

  • Specific activity determination with physiological substrates (PI4P)

  • Comparison with a reference standard or previous batch for consistency

  • Inhibition profile with known phosphatase inhibitors

Stability monitoring:

  • Activity retention after storage at different temperatures

  • Freeze-thaw stability testing

  • Long-term activity monitoring at recommended storage conditions

Quality Control ParameterAcceptance CriteriaMethod
Purity>90%SDS-PAGE, Mass Spectrometry
IdentityMatch to expected sequenceWestern blot, Mass Spectrometry
Enzymatic ActivityWithin 20% of reference standardPhosphatase assay
Stability<20% activity loss over recommended storage periodTime course activity testing
Endotoxin Level<1 EU/mg for cell-based assaysLAL test

What expression systems are optimal for producing functional recombinant Xenopus laevis SAC1 protein?

The choice of expression system significantly impacts the yield, folding, and functionality of recombinant Xenopus laevis SAC1 protein:

E. coli expression:

  • The most common system, as evidenced by the commercial recombinant SAC1 protein produced in E. coli

  • Advantages: High yield, cost-effective, rapid production

  • Limitations: Potential folding issues with complex domains, lack of post-translational modifications

  • Optimization strategies:

    • Use specialized strains (e.g., Rosetta for rare codons, Origami for disulfide bonds)

    • Lower induction temperature (16-20°C) to improve folding

    • Co-express with chaperones to enhance proper folding

    • Use solubility tags (e.g., MBP, SUMO) if inclusion bodies are problematic

Baculovirus/insect cell system:

  • Alternative for improved folding and post-translational modifications

  • Advantages: Better folding of complex proteins, some post-translational modifications

  • Limitations: Higher cost, longer production time

  • Best practices:

    • Optimize cell density and time of harvest

    • Consider adding lipids to culture media for membrane-associated proteins

    • Use fluorescent tags to monitor expression efficiency

Mammalian expression systems:

  • For highest fidelity to native structure and modifications

  • Advantages: Proper folding, authentic post-translational modifications

  • Limitations: Highest cost, lower yield, complex protocols

  • Recommended for:

    • Studies requiring native-like enzyme activity

    • Investigations of regulatory post-translational modifications

Xenopus oocytes:

  • Homologous expression system

  • Advantages: Native cellular environment for authentic folding and modifications

  • Limitations: Lower scalability, technically demanding

  • Particularly valuable for:

    • Functional studies requiring native regulatory machinery

    • Co-expression with other Xenopus proteins

The E. coli system has been successfully used for commercial production of recombinant Xenopus laevis SAC1 protein with His-tag , suggesting it provides adequate functionality for most applications while offering practical advantages in terms of yield and cost.

What are the recommended approaches for studying SAC1-mediated regulation of membrane trafficking in Xenopus systems?

Studying SAC1-mediated regulation of membrane trafficking in Xenopus systems requires specialized methodologies that leverage the unique advantages of this model organism:

Xenopus egg extracts for in vitro reconstitution:

  • Prepare cytoplasmic extracts from Xenopus eggs

  • Add recombinant SAC1 protein at varying concentrations

  • Monitor membrane dynamics using fluorescently labeled membranes

  • Quantify trafficking events through microscopy and biochemical assays

  • Compare with catalytically inactive SAC1 mutants as controls

Live imaging in Xenopus embryos:

  • Express fluorescently tagged SAC1 along with organelle markers

  • Perform high-resolution confocal microscopy in developing embryos

  • Use photobleaching techniques (FRAP, FLIP) to measure protein dynamics

  • Apply super-resolution microscopy for detailed subcellular localization

Membrane fractionation and lipidomics:

  • Isolate specific membrane compartments from Xenopus eggs or embryos

  • Analyze phosphoinositide composition using mass spectrometry

  • Compare lipid profiles between control and SAC1-manipulated samples

  • Correlate changes in phosphoinositide levels with trafficking defects

Animal cap explant cultures:

  • Isolate animal cap tissue from early Xenopus embryos

  • Manipulate SAC1 expression or activity in these explants

  • Examine effects on cell migration, adhesion, and tissue organization

  • Correlate these phenotypes with changes in membrane trafficking

Xenopus laevis offers significant advantages for these studies due to its amenability to microinjection, the large size of its cells (especially oocytes), and its well-characterized developmental processes . The ability to employ semi-intact and isolated preparations allows for detailed analysis of molecular mechanisms in a context that remains relevant to vertebrate development .

How can the phosphatase activity of recombinant Xenopus laevis SAC1 be quantitatively measured?

Quantitative measurement of recombinant Xenopus laevis SAC1 phosphatase activity requires rigorous biochemical approaches:

Malachite green phosphate detection assay:

  • Incubate SAC1 with substrate (e.g., PI4P) in appropriate buffer conditions

  • Stop reaction at specific timepoints

  • Add malachite green reagent to detect released phosphate

  • Measure absorbance at 620-640 nm

  • Calculate enzyme activity using a phosphate standard curve

Radiolabeled substrate approach:

  • Prepare ³²P-labeled phosphoinositide substrates

  • Incubate with recombinant SAC1

  • Extract lipids and separate by thin-layer chromatography

  • Visualize and quantify radioactive signals using phosphorimaging

  • Calculate specific activity based on substrate conversion

Fluorescence-based real-time assays:

  • Use synthetic fluorogenic substrates that change properties upon dephosphorylation

  • Monitor fluorescence changes in real-time during the reaction

  • Determine initial reaction rates at different substrate concentrations

  • Calculate kinetic parameters (Km, Vmax, kcat)

Optimal assay conditions for Xenopus laevis SAC1:

ParameterRecommended ConditionRationale
Temperature25°CMatches physiological temperature of Xenopus
pH6.8-7.2Optimal for SAC1 phosphatase activity
Buffer50 mM Tris or HEPESMaintains stable pH
Divalent cations2-5 mM MgCl₂Required cofactor for activity
Detergent0.1% Triton X-100Solubilizes lipid substrates
Reducing agent1-5 mM DTTMaintains cysteine residues in reduced state
Substrate concentration10-100 μM PI4PWithin range for Michaelis-Menten kinetics

For highest accuracy, researchers should establish a standard curve with each experiment and include appropriate controls such as heat-inactivated enzyme and known phosphatase inhibitors. This methodological rigor ensures reliable quantification of SAC1 phosphatase activity for comparative studies across different experimental conditions.

What techniques are appropriate for studying SAC1 protein-protein interactions in the Xenopus model system?

The study of SAC1 protein-protein interactions in Xenopus requires specialized techniques that leverage the unique advantages of this model system:

Co-immunoprecipitation from Xenopus egg extracts:

  • Prepare cytoplasmic extracts from Xenopus eggs or embryos

  • Add recombinant His-tagged SAC1 protein

  • Capture complexes using anti-His antibodies or Ni-NTA resin

  • Analyze binding partners by mass spectrometry or Western blotting

  • Validate interactions with reciprocal co-immunoprecipitations

Yeast two-hybrid screening with Xenopus cDNA libraries:

  • Use SAC1 as bait protein against Xenopus cDNA libraries

  • Identify potential interacting proteins

  • Validate candidates through biochemical approaches

  • Map interaction domains through truncation constructs

Bimolecular fluorescence complementation (BiFC) in Xenopus embryos:

  • Create fusion constructs with SAC1 and candidate interactors

  • Microinject mRNA encoding these constructs into embryos

  • Monitor for fluorescence reconstitution indicating protein interaction

  • Analyze subcellular localization of interaction events

Proximity labeling in Xenopus oocytes and embryos:

  • Express SAC1 fused to BioID or APEX2 in Xenopus systems

  • Allow proximity-dependent labeling to occur

  • Purify biotinylated proteins

  • Identify proximal proteins by mass spectrometry

FRET-based interaction analysis:

  • Generate fluorophore-tagged SAC1 and candidate interactors

  • Express in Xenopus embryos or oocytes

  • Perform FRET microscopy to detect protein proximity

  • Quantify interaction strength through FRET efficiency calculations

The Xenopus system's amenability to microinjection, large cell size, and external development make it particularly suitable for these interaction studies . Additionally, the ability to perform both in vivo studies in embryos and in vitro reconstitution experiments using egg extracts provides complementary approaches for comprehensive characterization of SAC1 protein-protein interactions.

How does SAC1 function relate to the unique developmental features of Xenopus laevis?

The function of SAC1 phosphatase in Xenopus laevis intersects with several distinctive developmental characteristics of this model organism:

Maternal to zygotic transition:
SAC1-regulated phosphoinositide pathways likely play important roles during the maternal-to-zygotic transition in Xenopus development. The ability to manipulate SAC1 activity through microinjection of recombinant protein or mRNA provides a powerful approach to study how phosphoinositide metabolism contributes to this critical developmental transition. Similar approaches have been successfully employed to study other regulatory factors in Xenopus, such as Sox17α, which is expressed throughout the endodermal region of the blastula .

Cell fate specification and tissue differentiation:
In Xenopus embryos, where cell fate specification and tissue differentiation are exceptionally well-characterized, SAC1-mediated regulation of membrane trafficking and signaling may contribute to:

  • Establishment of dorsal-ventral and anterior-posterior axes

  • Germ layer formation and specification, particularly in endoderm development

  • Cell migration during gastrulation

  • Tissue-specific differentiation programs

Metamorphosis-associated remodeling:
Xenopus undergoes dramatic metamorphosis from tadpole to adult form, involving extensive tissue remodeling. SAC1's roles in membrane dynamics may be particularly important during:

  • The developmental switch from larval tail-based swimming to adult limb-based locomotion

  • Neurological remodeling associated with changing lifestyle and behaviors

  • Reorganization of sensory systems during metamorphosis

The unique advantages of Xenopus as an experimental system, including its amenability to semi-intact and isolated preparations for in vitro morphophysiological experimentation, make it particularly valuable for studying SAC1 function during development . The established techniques for genetic manipulation and visualization in this model organism allow researchers to address fundamental questions about phosphoinositide signaling in vertebrate development.

What evolutionary insights can be gained from studying Xenopus laevis SAC1 compared to other vertebrate orthologs?

Comparative analysis of Xenopus laevis SAC1 with orthologs from other vertebrates provides valuable evolutionary insights:

Conservation of catalytic mechanisms:
The high degree of sequence conservation in the catalytic domains of SAC1 across vertebrates suggests fundamental importance in cellular function. Analysis of the Xenopus sequence (586 amino acids) compared to mammalian orthologs reveals:

  • Nearly identical catalytic residues indicating conserved enzymatic mechanism

  • Similar substrate specificity determinants suggesting conservation of physiological substrates

  • Preserved structural elements essential for membrane association

Divergence in regulatory domains:
While catalytic functions remain conserved, regulatory mechanisms may show greater evolutionary plasticity:

  • Lineage-specific adaptations in protein interaction motifs

  • Differential post-translational modification sites between amphibian and mammalian SAC1

  • Varied tissue expression patterns reflecting different developmental programs

Adaptations to environmental context:
Xenopus laevis, as an ectothermic amphibian, may display SAC1 adaptations that reflect its environmental context:

  • Temperature sensitivity profiles optimized for amphibian physiology

  • Potential differences in membrane composition accommodated by the lipid-binding domains

  • Regulatory mechanisms adapted to the unique developmental transitions of amphibians

Genome duplication considerations:
Xenopus laevis underwent a whole genome duplication event, potentially resulting in subfunctionalization of duplicated SAC1 genes:

  • Possible division of ancestral functions between paralogs

  • Tissue-specific expression patterns of different SAC1 variants

  • Differential regulation during development and metamorphosis

The study of Xenopus laevis as a model system has provided significant insights into vertebrate development , and comparative analysis of SAC1 across vertebrates can further illuminate the evolution of phosphoinositide signaling networks and their adaptation to diverse developmental programs.

How can experimental protocols be optimized for species-specific properties of Xenopus laevis SAC1?

Optimizing experimental protocols for Xenopus laevis SAC1 requires accounting for species-specific properties of this amphibian enzyme:

Temperature considerations:

  • Challenge: Standard mammalian conditions (37°C) may be suboptimal

  • Optimization strategies:

    • Conduct temperature optimization series (15-30°C) to determine activity peak

    • Design experiments to match the physiological temperature range of Xenopus

    • For comparative studies with mammalian orthologs, test multiple temperatures

    • Consider temperature sensitivity when designing long-duration experiments

Buffer composition adjustments:

  • Challenge: Standard buffers may not reflect Xenopus cellular environment

  • Optimization strategies:

    • Test multiple pH values within 6.0-8.0 range for optimal activity

    • Evaluate different buffer systems (HEPES, Tris, phosphate) for compatibility

    • Optimize ionic strength based on Xenopus intracellular conditions

    • Consider including physiologically relevant ions (Mg²⁺, Ca²⁺, K⁺)

Substrate preparation:

  • Challenge: Lipid substrates must be presented appropriately

  • Optimization strategies:

    • Use lipid compositions that mimic Xenopus cellular membranes

    • Compare different substrate presentation methods (micelles, liposomes, supported bilayers)

    • Consider extracting native membranes from Xenopus eggs for physiological substrates

    • Optimize protein:lipid ratios based on preliminary activity measurements

Expression system selection:

  • Challenge: Ensuring proper folding and modification

  • Optimization strategies:

    • Compare activity of SAC1 expressed in different systems (E. coli , insect cells, mammalian cells)

    • Test different purification tags and their position (N-terminal vs. C-terminal)

    • Optimize purification protocols to maintain native conformation

    • Consider expression in Xenopus oocytes for homologous production

Optimal conditions matrix:

ParameterTest RangeEvaluation MethodExpected Optimum
Temperature15-30°CPhosphatase activity assay22-25°C
pH6.0-8.0pH activity profile7.0-7.5
Salt concentration50-200 mM NaClActivity vs. salt curve~100 mM
Mg²⁺ concentration0-10 mMActivity titration2-5 mM
Detergent typeTriton X-100, NP-40, CHAPSComparative activity0.05-0.1% Triton X-100

These optimization strategies leverage the knowledge gained from extensive work with Xenopus as a model system in developmental and molecular biology , ensuring that experimental conditions are appropriate for the unique properties of this amphibian enzyme.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.