Recombinant Xenopus laevis Potassium channel subfamily K member 9 (kcnk9)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. For precise delivery estimates, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipment, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by multiple factors including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you have a preferred tag type, please inform us, and we will prioritize its development.
Synonyms
kcnk9; Potassium channel subfamily K member 9
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-374
Protein Length
full length protein
Species
Xenopus laevis (African clawed frog)
Target Names
kcnk9
Target Protein Sequence
MKRQNVRTLSLIICTFTYLLVGAAVFDALESDYEMREEEKLKAEEIRLKGKYNISSEDYR QLELVIMQSEPHRAGVQWKFAGSFYFAITVITTIGYGHAAPGTDAGKAFCMFYAVLGIPL TLVMFQSLGERMNTFVKYLLKRIKKCCGMHSTDVSMENMVTVGFFSCMGTLCIGAAAFSH YEEWSFFQAYYYCFITLTTIGFGDYVALQKNRALQKKPLYVAFSFMYILVGLTVIGAFLN LVVLRFLTMNSEDERRDAEERASLAGNRNSMIIHIQEDTPHGRQRYKAEVTDLQSVCSCM CYRSHEYTSRMVSHQNSFSSKLNPQYFHSISYKIEEISPSTLKNSLFPSPVSSVSPGLHS FTDKHRLMKRRKSI
Uniprot No.

Target Background

Function
This protein is a pH-dependent, voltage-insensitive potassium channel with background activity.
Database Links

KEGG: xla:494803

UniGene: Xl.49723

Protein Families
Two pore domain potassium channel (TC 1.A.1.8) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

Why is Xenopus laevis a valuable model organism for studying potassium channels?

Xenopus laevis serves as an excellent model organism for studying potassium channels for several reasons:

  • Evolutionary position: As an amphibian, Xenopus occupies a phylogenetically intermediate position between aquatic vertebrates and land tetrapods, making it valuable for evolutionary studies of ion channels .

  • External development: Xenopus embryos develop externally, free from maternal influence, allowing easy experimental access from early developmental stages .

  • Temperature tolerance: Xenopus exhibits broad temperature tolerance, which facilitates various experimental manipulations that might not be possible with mammalian models .

  • Genomic resources: The availability of genomic and genetic tools for Xenopus, including genome sequencing and annotated databases, enhances the molecular characterization of ion channels .

  • Transgenic capabilities: Well-established protocols for generating transgenic Xenopus lines allow for in vivo studies of potassium channel function, including conditional expression systems using Cre recombinase technology .

These characteristics make Xenopus particularly valuable for electrophysiological studies and for investigating the developmental roles of potassium channels .

What are the recommended approaches for recombinant expression of Xenopus laevis kcnk9?

For successful recombinant expression of Xenopus laevis kcnk9, consider the following methodological approaches:

Expression Systems:

  • E. coli-based expression: Suitable for producing His-tagged recombinant kcnk9 protein, though proper folding of membrane proteins can be challenging .

  • Mammalian cell expression: HEK293 cells provide a eukaryotic environment that supports proper folding and post-translational modifications of kcnk9 .

  • Xenopus oocyte expression: The native cellular environment for functional expression and electrophysiological studies .

Expression Protocol Framework:

  • Clone the full-length kcnk9 coding sequence (1-374 aa) into an appropriate expression vector

  • Add an N-terminal His-tag for purification purposes

  • Transform/transfect the expression system

  • Induce protein expression under optimized conditions

  • Purify using affinity chromatography

  • Store in an appropriate buffer (e.g., Tris-based with 50% glycerol) at -20°C/-80°C

Critical Considerations:

  • When expressing membrane proteins like kcnk9, inclusion of detergents or lipid nanodisc technologies may be necessary to maintain proper folding and function

  • For functional studies, co-expression with interacting partners may be required, as some potassium channels require assembly with other subunits to form functional channels

  • Repeated freeze-thaw cycles should be avoided; working aliquots should be stored at 4°C for up to one week

What experimental designs are most effective for studying kcnk9 function in Xenopus models?

When designing experiments to study kcnk9 function in Xenopus models, researchers should consider both in vitro and in vivo approaches:

In Vitro Approaches:

  • Electrophysiological studies: Whole-cell patch-clamp recordings can measure K+ currents directly. This approach has been successfully used with potassium channels expressed in various cell types .

    Measurement TypeParameters to RecordTypical Values for K+ Channels
    Whole-cell currentCurrent density (pA/pF)10-100 pA/pF for leak channels
    Single channelConductance2-10 pS for K2P channels
    Voltage sensitivityV₅₀ activation-50 to -20 mV
  • FRET-FLIM measurements: Can be used to monitor intracellular K+ concentrations in response to kcnk9 expression or manipulation .

In Vivo Approaches:

  • Transgenic expression studies:

    • Heat-shock inducible promoters for temporal control of kcnk9 expression

    • Tissue-specific promoters (e.g., cardiac actin promoter) for spatial control

    • Cre-loxP systems for conditional expression

  • Loss-of-function studies:

    • Morpholino-based knockdown

    • CRISPR/Cas9 genome editing for targeted kcnk9 mutation

  • Phenotypic analysis:

    • Developmental timing assessments

    • Morphological measurements

    • Behavioral assays

    • Tissue growth and patterning analysis

Experimental Design Principles:

  • Include appropriate controls (e.g., uninjected controls, scrambled morpholinos, GFP-only expression)

  • Use multiple biological replicates (minimum n=3 for preliminary studies, n>10 for definitive studies)

  • Incorporate both gain- and loss-of-function approaches for comprehensive understanding

  • Consider stage-specific effects by conducting experiments at multiple developmental timepoints

How can researchers optimize electrophysiological recordings of kcnk9 channels?

Optimizing electrophysiological recordings of kcnk9 channels requires careful attention to technical details:

Preparation Considerations:

  • Expression system selection: While Xenopus oocytes are commonly used, certain mammalian cell lines may provide a more stable background for precise measurements of leak channel activity.

  • Expression level control: Titrate the amount of cDNA or mRNA to achieve consistent expression levels across experimental groups.

  • Incubation conditions: For Xenopus oocytes, maintain at 18°C in appropriate medium; for mammalian cells, standard culture conditions should be followed.

Recording Parameters:

  • Solution composition:

    SolutionK+ (mM)Na+ (mM)Cl- (mM)Ca2+ (mM)Mg2+ (mM)pHNotes
    External bath2-5140-150150-1601-21-27.4Physiological K+
    High K+ bath90-1405-50150-1601-21-27.4For K+ selectivity
    Internal pipette140-1500-510-200.1-11-27.2With EGTA buffer
  • Voltage protocols:

    • Holding potential typically -80 mV

    • Voltage steps from -120 mV to +60 mV in 10-20 mV increments

    • Ramp protocols from -120 mV to +60 mV over 1-2 seconds

    • Temperature control at room temperature (22-25°C) for consistency

  • Pharmacological tools:

    • Test channel blockers (e.g., barium, quinine) to verify specific kcnk9 currents

    • Apply calcineurin inhibitors (e.g., FK506) to assess regulation by phosphorylation

Analysis Approaches:

  • Calculate current-voltage (I-V) relationships from steady-state currents

  • Determine reversal potentials under varying K+ concentrations to confirm K+ selectivity

  • Assess time-dependent characteristics (activation, inactivation)

  • Compare experimental results with computational models based on the kcnk9 structure

Methodological Controls:

  • Record from non-transfected/non-injected cells to establish baseline leak currents

  • Include positive controls (known K+ channels) to validate recording conditions

  • Perform measurements of background conductance before and after specific blockers

How does the function of Xenopus laevis kcnk9 compare with its homologs in other species?

Comparative analysis of kcnk9 across species reveals important evolutionary and functional insights:

Cross-Species Functional Conservation:

SpeciesProtein NameIdentity to X. laevis kcnk9Key Functional DifferencesReference
HumanKCNK9 (TASK-3)~70-75%Higher sensitivity to acidification; implicated in cancer
MouseKcnk9~75-80%Similar pharmacology; involved in sleep regulation
Zebrafishkcnk9~65-70%Expression pattern more restricted to neural tissues
RatKcnk9~75-80%Comparable electrophysiological properties

Research has shown that while the basic electrophysiological properties of kcnk9 channels are conserved across species, there are notable differences:

  • Regulatory mechanisms: Calcineurin-mediated regulation appears to be a conserved feature, with phosphorylation sites like Serine345 in zebrafish playing crucial roles. Similar phosphorylation-dependent regulation has been observed in Xenopus kcnk9, though the exact sites may differ .

  • Developmental functions: In zebrafish, kcnk9 and related channels like kcnk5b influence developmental signaling pathways that control appendage scaling. In Xenopus, preliminary evidence suggests roles in embryonic development, particularly in neural tissues .

  • Channel assembly: Like its mammalian counterparts, Xenopus kcnk9 likely forms functional homodimers, but may also form heterodimers with other K2P family members, potentially creating channels with unique properties .

  • Pharmacological profile: While general K+ channel blockers affect kcnk9 across species, subtle differences in drug sensitivity may exist and should be experimentally verified when translating findings between species .

These comparative insights are valuable for researchers using Xenopus as a model system, as they help contextualize findings within broader evolutionary and functional frameworks.

What role does kcnk9 play in bioelectric signaling during Xenopus development?

The role of kcnk9 in bioelectric signaling during Xenopus development represents an emerging area of research with significant implications for understanding morphogenesis and pattern formation.

Bioelectric Signaling Mechanisms:
Potassium leak channels like kcnk9 contribute to establishing resting membrane potential (Vmem) in cells. Changes in Vmem can initiate downstream signaling cascades that influence developmental processes through:

  • Direct effects on voltage-sensitive proteins

  • Altered ion concentrations affecting second messenger systems

  • Changes in gap junction-mediated intercellular communication

  • Influence on morphogen gradient formation and interpretation

Developmental Processes Potentially Regulated by kcnk9:

Based on research in related systems and preliminary work in Xenopus, kcnk9 may participate in:

  • Neural development: Expression patterns suggest roles in neural patterning and neuronal differentiation.

  • Appendage formation and scaling: In zebrafish, the related channel kcnk5b regulates fin growth and scaling through activation of developmental pathways. Evidence suggests kcnk9 may have similar roles in Xenopus limb development .

  • Left-right patterning: Bioelectric signals are crucial for establishing left-right asymmetry in Xenopus, and K+ channels contribute to this process.

  • Regenerative processes: Xenopus tadpoles can regenerate tails and limbs, processes that involve bioelectric signaling potentially mediated by channels like kcnk9.

Molecular Pathways Influenced by kcnk9 Activity:

Research in zebrafish and other systems suggests kcnk9 activity may influence:

  • Shh (Sonic hedgehog) signaling: K+ channel activity can modulate Shh pathway activation, which is crucial for tissue patterning .

  • Wnt/β-catenin signaling: Evidence indicates K+ channel-mediated changes in membrane potential can affect Lef1 activity and other components of Wnt signaling .

  • Notch signaling: Preliminary evidence suggests potential cross-talk between bioelectric signals and Notch pathway activation.

  • Growth factor signaling: Changes in membrane potential may alter the sensitivity of cells to growth factors during development.

Experimental Evidence from Transgenic Studies:
Transgenic approaches using heat-shock or tissue-specific promoters to drive kcnk9 expression in Xenopus have demonstrated:

  • Changes in cell proliferation patterns

  • Altered expression of developmental genes

  • Modified tissue patterning and growth characteristics

These findings align with the hypothesis that kcnk9-mediated bioelectric signals serve as upstream regulators of multiple developmental pathways .

How can recombinant kcnk9 be used for structure-function relationship studies?

Structure-function relationship studies of recombinant kcnk9 can provide valuable insights into channel mechanics, regulation, and potential therapeutic targets. Here are methodological approaches for such investigations:

Structural Analysis Approaches:

  • Computational modeling:

    • Homology modeling based on crystal structures of related K2P channels

    • Molecular dynamics simulations to analyze ion permeation pathways

    • Docking studies to identify potential binding sites for modulators

  • Biophysical techniques:

    • Circular dichroism spectroscopy to analyze secondary structure

    • Fluorescence spectroscopy to examine conformational changes

    • Analytical ultracentrifugation to study oligomeric states

  • Advanced structural biology:

    • Cryo-electron microscopy of purified kcnk9

    • X-ray crystallography (challenging for membrane proteins but potentially feasible with appropriate constructs)

    • Nuclear magnetic resonance (NMR) of specific domains

Mutagenesis Strategies:

Systematic mutagenesis studies can identify critical structural elements:

  • Channel pore region mutations: Alterations to the K+ selectivity filter can provide insights into ion selectivity and conductance mechanisms.

  • Transmembrane domain mutations: Changes to these regions can reveal information about channel gating and structural stability.

  • C-terminal domain mutations: The C-terminus contains regulatory sites, including the calcineurin-regulated Serine345 in related channels. Similar phosphorylation sites can be identified and mutated in Xenopus kcnk9 .

    Mutation TypeTarget RegionExpected EffectAnalytical Approach
    Alanine scanningPore domainAltered conductanceElectrophysiology
    Charge reversalTransmembrane helicesModified gatingVoltage-clamp recordings
    Phospho-mimetic (S→D)C-terminal domainConstitutive activationPatch-clamp & biochemical assays
    Phospho-null (S→A)C-terminal domainPrevention of regulationPatch-clamp & biochemical assays
  • Domain swapping: Exchanging domains between kcnk9 and other K2P channels can identify regions responsible for specific functional properties.

Functional Assessment Methods:

  • Electrophysiological analysis:

    • Voltage-clamp recordings to determine basic channel properties

    • Single-channel recordings to examine individual channel behavior

    • Noise analysis to estimate channel numbers and kinetics

  • Pharmacological profiling:

    • Dose-response curves for known K+ channel modulators

    • Identification of kcnk9-specific modulators through screening approaches

    • Analysis of state-dependent drug interactions

  • Interaction studies:

    • Co-immunoprecipitation to identify binding partners

    • Fluorescence resonance energy transfer (FRET) to examine protein-protein interactions

    • Surface plasmon resonance to quantify binding kinetics

Integration with Functional Studies:

Structure-function findings can be validated through:

  • Expression of mutant channels in Xenopus oocytes or cell lines

  • Generation of transgenic Xenopus lines expressing modified kcnk9

  • Electrophysiological recordings from native tissues expressing modified channels

What statistical approaches are most appropriate for analyzing kcnk9 electrophysiological data?

Analyzing electrophysiological data from kcnk9 studies requires robust statistical approaches to account for the inherent variability in biological and experimental systems:

Pre-analysis Considerations:

  • Data normalization strategies:

    • Normalization to cell capacitance (pA/pF) for whole-cell recordings

    • Normalization to maximum response for dose-response relationships

    • Internal controls when comparing multiple experimental conditions

  • Outlier identification:

    • Grubb's test or modified z-score methods for detecting outliers

    • Consider biological plausibility before excluding data points

    • Document all excluded data points and justification in methods

Statistical Testing Framework:

  • For comparing two experimental conditions:

    • Student's t-test (paired or unpaired) for normally distributed data

    • Mann-Whitney U test for non-normally distributed data

    • Effect size calculations (Cohen's d) to quantify magnitude of differences

  • For multiple experimental conditions:

    • One-way ANOVA with appropriate post-hoc tests (Tukey, Bonferroni, etc.)

    • Kruskal-Wallis test for non-parametric data

    • Mixed-effects models for repeated measures designs

  • For dose-response or voltage-response relationships:

    • Nonlinear regression analysis (Hill equation, Boltzmann function)

    • Comparison of curve parameters (EC50, Vhalf, slope factors)

    • Bootstrap analysis for confidence intervals of fitted parameters

    ParameterDescriptionTypical Analysis Method
    Current amplitudeMaximum current at specified voltageANOVA or t-test
    I-V relationshipCurrent across voltage rangeRegression analysis
    EC50Half-maximal effective concentrationNonlinear regression
    τ (tau)Time constant for activation/inactivationExponential fitting
    Open probabilityChannel opening likelihoodBinomial/Bayesian analysis

Advanced Statistical Approaches:

  • Bayesian inference methods: Particularly useful for single-channel analysis and when incorporating prior knowledge about channel behavior

  • Machine learning techniques: Can help identify patterns in complex electrophysiological datasets, especially when examining multiple channel parameters simultaneously

  • Power analysis: Essential for experimental design to determine appropriate sample sizes:

    • For detecting 20% changes in current amplitude with 80% power at α=0.05, typically requires n=8-12 cells per condition

    • Larger sample sizes needed when examining subtle modulatory effects

Visualization Strategies:

  • Primary data visualization:

    • Raw current traces with appropriate time and current scales

    • I-V plots with error bars (standard error or confidence intervals)

    • Box plots or violin plots for distribution of responses across conditions

  • Derived data visualization:

    • Bar graphs for normalized responses

    • Heat maps for multiple parameter comparisons

    • Forest plots for meta-analysis of multiple experiments

Reproducibility Considerations:

  • Report detailed statistical methods, including software packages and versions

  • Provide both raw and normalized data when possible

  • Include precise p-values rather than p-value ranges 7

What approaches can resolve contradictory findings in kcnk9 functional studies?

Resolving contradictory findings in kcnk9 functional studies requires systematic investigation of potential sources of variability and careful experimental design:

Common Sources of Contradictions:

  • Experimental system differences:

    • Expression level variations in heterologous systems

    • Different cellular backgrounds affecting channel regulation

    • Variations in recording conditions (temperature, solutions)

  • Channel isoform and species differences:

    • Splicing variants with altered functional properties

    • Species-specific differences in channel regulation

    • Post-translational modifications varying between systems

  • Methodological variations:

    • Differences in recording techniques (two-electrode voltage clamp vs. patch clamp)

    • Solution composition affecting channel behavior

    • Temporal factors (acute vs. chronic manipulations)

Resolution Framework:

  • Standardization approaches:

    • Develop consensus protocols for kcnk9 expression and recording

    • Use identical constructs and expression systems when comparing results

    • Implement internal controls for calibrating measurements across laboratories

  • Systematic replication studies:

    • Independent replication with blinded analysis

    • Multi-laboratory collaborative studies

    • Pre-registered experimental designs with defined analysis plans

  • Reconciliation through expanded experimental paradigms:

    • Test multiple hypotheses that could explain contradictions

    • Examine condition-dependent effects (pH, temperature, cell type)

    • Consider combinatorial effects with other channels or regulatory proteins

Analytical Strategies for Contradictory Data:

  • Meta-analysis approaches:

    • Quantitative synthesis of published results

    • Weighting of studies based on methodology quality

    • Identification of moderator variables explaining divergent findings

  • Computational modeling:

    • Develop models incorporating variables that might explain contradictions

    • Test whether apparent contradictions can be resolved by accounting for specific factors

    • Use sensitivity analysis to identify critical parameters

  • Data sharing and re-analysis:

    • Open data repositories for raw electrophysiological recordings

    • Alternative analytical approaches applied to existing datasets

    • Collaborative platforms for comparing methodologies

Case Study Approach:

When contradictory findings emerge regarding kcnk9 function, consider implementing a structured investigation:

  • Clearly define the specific contradiction (e.g., different pharmacological responses)

  • Catalog methodological differences between contradictory studies

  • Design experiments that systematically vary each potential factor

  • Implement blinded analysis to minimize bias

  • Report both positive and negative results comprehensively

This approach has successfully resolved contradictions in other ion channel fields and can be applied to kcnk9 research to advance understanding of this important potassium channel 7.

How can researchers integrate kcnk9 electrophysiological data with developmental biology findings?

Integrating electrophysiological data with developmental biology findings presents challenges due to differences in methodologies, timescales, and analytical frameworks. Here are approaches to create meaningful connections between these research domains:

Integration Strategies:

  • Temporal correlation studies:

    • Map electrophysiological changes to specific developmental stages

    • Conduct time-course experiments monitoring both channel activity and developmental markers

    • Analyze whether changes in kcnk9 activity precede or follow developmental events

  • Spatial correlation analysis:

    • Compare tissue-specific kcnk9 expression patterns with developmental processes

    • Use tissue-specific promoters to manipulate kcnk9 activity in defined cell populations

    • Analyze regional differences in membrane potential relative to morphogenetic events

  • Causal relationship testing:

    • Use inducible expression systems to activate or inhibit kcnk9 at precise developmental timepoints

    • Measure both electrophysiological parameters and developmental outcomes after manipulation

    • Implement rescue experiments to confirm specificity of observed effects

Technical Approaches for Integration:

  • Combined experimental platforms:

    • In vivo imaging of membrane potential in developing embryos (using voltage-sensitive dyes)

    • Simultaneous recording of electrical activity and gene expression (patch clamp followed by single-cell transcriptomics)

    • Integration of optogenetic tools to manipulate membrane potential while observing development

  • Multiscale modeling:

    • Combine cell-level electrophysiological models with tissue-level morphogenetic models

    • Predict how changes in kcnk9 activity might alter developmental trajectories

    • Test model predictions through targeted experiments

  • Molecular pathway analysis:

    • Identify signaling pathways influenced by both kcnk9 activity and developmental processes

    • Test whether manipulation of these shared pathways mimics kcnk9-related phenotypes

    • Measure pathway activity after kcnk9 modulation using reporter assays

Example Integration Framework:

Level of AnalysisElectrophysiological MeasurementDevelopmental AssessmentIntegration Method
MolecularSingle-channel kcnk9 propertiesGene expression changesCorrelation analysis after channel modulation
CellularMembrane potential changesCell proliferation/differentiationTime-lapse imaging with voltage sensors
TissueField potential recordingsMorphogenetic movementsSimultaneous imaging of voltage and cell behaviors
OrganismGlobal bioelectrical patternsPhenotypic outcomesStatistical modeling of electrophysiology-phenotype relationships

Case Example from Research:

Studies in zebrafish have successfully integrated K+ channel (kcnk5b) electrophysiology with developmental biology by:

  • Demonstrating that channel activity influences membrane potential

  • Showing that changes in membrane potential affect intracellular calcium dynamics

  • Linking calcium changes to activation of calcineurin phosphatase

  • Demonstrating calcineurin regulation of channel activity through phosphorylation

  • Connecting this regulatory loop to activation of developmental pathways (Shh, Lef1)

  • Ultimately explaining how bioelectric mechanisms control appendage scaling

Similar integrative approaches can be applied to study Xenopus kcnk9 in developmental contexts, potentially revealing conserved or divergent mechanisms across species .

How does the genomic organization of kcnk9 in Xenopus laevis compare to other species?

The genomic organization of kcnk9 in Xenopus laevis presents interesting features due to the species' pseudotetraploid genome, offering valuable evolutionary insights when compared to other vertebrates:

Genomic Structure in Xenopus laevis:

Xenopus laevis underwent a whole genome duplication event approximately 17-18 million years ago, resulting in a pseudotetraploid genome with distinct L (long) and S (short) chromosomal subgenomes. This genomic architecture has important implications for kcnk9:

  • Gene duplication: Unlike diploid species with typically single kcnk9 genes, X. laevis may have two copies (kcnk9.L and kcnk9.S) located on different chromosomes .

  • Subgenome evolution: Evidence suggests differential retention and silencing of duplicated genes across the X. laevis genome. For some gene families, one copy may be functionally silenced or exhibit subfunctionalization .

  • Intron-exon organization: The basic gene structure of kcnk9 is likely conserved, with X. laevis maintaining the typical structural organization seen in other vertebrates, despite potential duplications.

Cross-Species Comparison:

SpeciesChromosome LocationGene StructureCopy NumberNotable Features
X. laevisPotential dual location on L and S chromosomesLikely 2-3 exonsPotentially 2 copiesGene duplicates may show differential expression patterns
X. tropicalisSingle chromosomal location2-3 exonsSingle copyDiploid genome simplifies genetic analysis
Human8q24.32 exonsSingle copyContains large intron; complex regulation
Mouse15q2 exonsSingle copySimilar to human organization
ZebrafishUnknownLikely 2-3 exonsPotentially multiple paralogsTeleost-specific genome duplication

Evolutionary Implications:

  • Subfunctionalization: In X. laevis, the two kcnk9 copies may have evolved partially overlapping but distinct functions, potentially expanding the channel's role in development and physiology.

  • Expression divergence: Differential regulation of the duplicated genes may result in distinct spatial or temporal expression patterns, as observed for other duplicated genes in X. laevis .

  • Conservation of critical domains: Despite potential duplication, functional domains critical for channel activity (pore domains, transmembrane regions) are likely highly conserved across species.

  • Regulatory evolution: Promoter and regulatory regions may show greater divergence than coding sequences, potentially leading to novel expression patterns for duplicated genes.

Methodological Considerations for Research:

  • When designing primers or probes for Xenopus kcnk9, researchers should account for potential gene duplication and sequence divergence.

  • Expression studies should consider the possibility of subgenome-specific transcripts with distinct regulation.

  • Functional studies should address whether multiple kcnk9 gene products exist and if they have distinct or redundant roles.

  • Comparative genomic approaches can leverage the unique evolutionary position of Xenopus to understand potassium channel evolution more broadly .

What are the key differences in kcnk9 regulation between Xenopus and mammalian systems?

Understanding the differences in kcnk9 regulation between Xenopus and mammalian systems provides important insights for translational research and evolutionary biology:

Transcriptional Regulation:

  • Developmental expression patterns:

    • In Xenopus, kcnk9 expression appears to be more dynamic during development, with potential roles in embryogenesis

    • Mammalian kcnk9 shows more restricted expression, predominantly in neural tissues and specific peripheral organs

    • These differences may reflect divergent roles in development and physiology

  • Tissue distribution:

    • While comprehensive expression data for Xenopus kcnk9 is limited, evidence suggests broader expression across tissues compared to mammals

    • Mammalian kcnk9 shows highest expression in the central nervous system, with lower expression in some peripheral tissues

    • These differences should be considered when extrapolating findings between species

Post-translational Regulation:

  • Phosphorylation mechanisms:

    • Both Xenopus and mammalian kcnk9 contain phosphorylation sites, but specific sites may differ

    • Calcineurin-mediated regulation has been demonstrated in related channels in zebrafish and appears conserved, but the specific target residues may vary between species

    • Protein kinase A (PKA) and protein kinase C (PKC) regulation may differ in their effects between species

  • Protein-protein interactions:

    • Mammalian kcnk9 interacts with 14-3-3 proteins in a phosphorylation-dependent manner

    • These interactions may be conserved in Xenopus but possibly with different binding characteristics

    • Scaffolding protein interactions that regulate channel trafficking and localization may show species-specific patterns

Pharmacological Regulation:

  • pH sensitivity:

    • Mammalian kcnk9 shows characteristic inhibition by extracellular acidification

    • Xenopus kcnk9 may exhibit different pH sensitivity due to amino acid variations in key sensing domains

    • These differences can affect experimental design when using pH modulation as a tool

  • Modulation by anesthetics and other compounds:

    • Mammalian kcnk9 is modulated by volatile anesthetics, enhancing channel activity

    • The sensitivity profile of Xenopus kcnk9 to these compounds may differ

    • Species-specific pharmacological profiles should be established experimentally

Temperature-Dependent Regulation:

  • Operating temperature ranges:

    • Xenopus, as a poikilothermic organism, has adapted ion channels to function across broader temperature ranges

    • Mammalian kcnk9 is optimized for function at constant body temperature

    • These adaptations may manifest as differences in temperature sensitivity and gating kinetics

Regulatory Implications for Research:

When using Xenopus as a model for kcnk9 studies, researchers should:

  • Validate regulatory mechanisms empirically rather than assuming conservation from mammalian systems

  • Consider temperature as an experimental variable that may differentially affect channel function across species

  • Establish Xenopus-specific pharmacological profiles rather than relying solely on mammalian data

  • Explore potential divergence in signaling pathways that regulate channel activity

  • Account for potential subfunctionalization of duplicated genes in regulatory studies

How can evolutionary analysis of kcnk9 inform functional studies in Xenopus models?

Evolutionary analysis of kcnk9 provides valuable context for functional studies in Xenopus models, offering insights into conserved mechanisms and species-specific adaptations:

Evolutionary Conservation Analysis:

  • Positive selection analysis:

    • Identify regions under positive selection that may indicate species-specific adaptations

    • Correlate positively selected sites with functional differences between species

    • Explore how selection pressure relates to environmental adaptations (temperature, pH tolerance)

Functional Divergence Insights:

  • Paralog comparison approaches:

    • Compare kcnk9 with other K2P family members (kcnk3, kcnk5, etc.) within Xenopus

    • Identify subfunctionalization patterns after gene duplication events

    • Use paralog comparison to predict unique functional properties of kcnk9

  • Lineage-specific feature analysis:

    • Identify amphibian-specific features of kcnk9 that may relate to unique physiological demands

    • Compare aquatic versus terrestrial vertebrate kcnk9 properties

    • Correlate channel properties with ecological and physiological adaptations

Application to Experimental Design:

Evolutionary InsightExperimental ApplicationExpected Benefit
Conserved motifsTargeted mutagenesisIdentification of fundamental functional elements
Divergent regionsChimeric channel constructionUnderstanding of species-specific adaptations
Lineage-specific sitesSite-directed mutagenesisInsight into amphibian-specific functions
Selection patternsCorrelation with functional propertiesPrediction of environmentally relevant adaptations

Integration with Developmental Studies:

Evolutionary analysis can guide developmental studies by:

  • Temporal expression correlation:

    • Compare developmental expression patterns of kcnk9 across species

    • Identify conserved versus divergent developmental roles

    • Predict critical developmental periods where kcnk9 function is essential

  • Regulatory network evolution:

    • Analyze conservation of transcription factor binding sites in kcnk9 promoters

    • Compare regulatory networks controlling kcnk9 expression across species

    • Identify evolutionary shifts in regulatory mechanisms

  • Phenotypic impact prediction:

    • Use evolutionary patterns to predict phenotypic consequences of kcnk9 manipulation

    • Compare developmental functions across species with different kcnk9 evolutionary histories

    • Estimate the degree of functional redundancy based on evolutionary relationships

Practical Implementation Strategies:

  • Begin with comprehensive phylogenetic analysis of K2P channels across vertebrates

  • Generate sequence alignments focusing on functional domains and regulatory motifs

  • Use evolutionary constraints to guide experimental design:

    • Target highly conserved regions for loss-of-function studies

    • Examine divergent regions for species-specific functions

    • Explore lineage-specific features for adaptation-related properties

  • Implement cross-species functional comparisons:

    • Express kcnk9 from different species in identical systems

    • Compare electrophysiological and developmental effects

    • Correlate functional differences with evolutionary divergence

This evolutionary-informed approach can significantly enhance the interpretability and broader relevance of Xenopus kcnk9 studies, connecting molecular mechanisms to adaptive evolution .

What emerging technologies hold promise for advancing kcnk9 research in Xenopus models?

Several cutting-edge technologies are poised to transform research on kcnk9 in Xenopus models, offering unprecedented capabilities for investigating channel function, regulation, and developmental roles:

Advanced Genomic Engineering:

  • CRISPR-Cas9 applications:

    • Precise genome editing for creating kcnk9 knockout or knockin Xenopus lines

    • Base editing technologies for introducing specific point mutations

    • Prime editing for making precise changes without double-strand breaks

    • CRISPR activation/inhibition systems for modulating kcnk9 expression without altering sequence

  • Single-cell genomics:

    • Single-cell RNA sequencing to map kcnk9 expression across cell types during development

    • Spatial transcriptomics to correlate kcnk9 expression with morphogenetic events

    • ATAC-seq to profile chromatin accessibility at the kcnk9 locus during development

    • Clonal tracing techniques to follow kcnk9-expressing cells throughout development

Advanced Imaging Technologies:

  • Voltage imaging approaches:

    • Genetically-encoded voltage indicators (GEVIs) expressed alongside kcnk9

    • High-speed fluorescence imaging to capture membrane potential dynamics

    • Two-photon microscopy for deeper tissue imaging of bioelectric patterns

    • Correlative light and electron microscopy to link channel distribution with function

  • Super-resolution microscopy:

    • STORM/PALM imaging of kcnk9 distribution at nanoscale resolution

    • Expansion microscopy to visualize channel clustering and interactions

    • Live-cell super-resolution to track channel dynamics in real time

    • Multi-color imaging to visualize kcnk9 interactions with regulatory proteins

Functional Manipulation Technologies:

  • Optogenetic and chemogenetic approaches:

    • Light-activated potassium channels to mimic or counteract kcnk9 activity

    • Chemically-induced dimerization systems for controlling kcnk9 activity

    • Photoactivatable kcnk9 variants for spatiotemporal control of channel function

    • Targeted degradation of kcnk9 using photosensitive degron systems

  • Microfluidic and organ-on-chip platforms:

    • Precise control of the developmental microenvironment

    • High-throughput screening of compounds affecting kcnk9 function

    • Integration with electrophysiological recording capabilities

    • Long-term culture of Xenopus tissues for extended developmental studies

Computational and Systems Biology Approaches:

  • Advanced modeling techniques:

    • Multi-scale models integrating molecular dynamics with tissue-level effects

    • Machine learning for predicting kcnk9 functional impacts from sequence data

    • Network analysis to position kcnk9 within developmental gene regulatory networks

    • Agent-based modeling of cell behaviors influenced by bioelectric signaling

  • Integrative data analysis frameworks:

    • Multi-omics data integration to connect kcnk9 activity with broader cellular responses

    • Causal inference methods to establish directional relationships in regulatory networks

    • Cloud-based collaborative platforms for sharing complex datasets

    • Visualization tools for complex spatiotemporal data

Implementation Strategy:

To effectively leverage these emerging technologies, researchers should:

  • Establish interdisciplinary collaborations combining expertise in electrophysiology, developmental biology, and cutting-edge technology application

  • Develop standardized protocols for implementing new technologies in Xenopus systems

  • Create benchmarking systems to compare results across technological platforms

  • Establish centralized resources for sharing tools, protocols, and data

These technological advances promise to provide unprecedented insights into kcnk9 function in Xenopus models, potentially revealing novel mechanisms in bioelectric signaling and developmental regulation .

What are the most significant unanswered questions about kcnk9 function in Xenopus development?

Despite advances in understanding potassium channels, several critical questions about kcnk9 function in Xenopus development remain unanswered:

Developmental Expression and Regulation:

  • Precise spatiotemporal expression patterns:

    • When and where is kcnk9 expressed during Xenopus development?

    • Do expression patterns differ between duplicated gene copies (kcnk9.L and kcnk9.S)?

    • How does kcnk9 expression correlate with specific morphogenetic events?

  • Transcriptional regulation mechanisms:

    • What transcription factors control kcnk9 expression during development?

    • Are there developmental stage-specific enhancers or repressors?

    • How is kcnk9 expression coordinated with other bioelectric components?

Functional Roles in Development:

  • Contribution to bioelectric patterns:

    • How does kcnk9 activity shape membrane potential distributions in developing embryos?

    • Are there critical periods where kcnk9 function is essential for normal development?

    • Does kcnk9 participate in bioelectric gradients that guide cell behaviors?

  • Morphogenetic influences:

    • Does kcnk9 activity affect cell migration, proliferation, or differentiation?

    • Are kcnk9-dependent bioelectric signals involved in tissue patterning or organ formation?

    • How does kcnk9 function interact with classical morphogen gradients?

Molecular Signaling Integration:

  • Pathway interactions:

    • How does kcnk9 activity interact with known developmental signaling pathways (Wnt, Notch, BMP, etc.)?

    • Is kcnk9 function upstream or downstream of these pathways, or do they operate in parallel?

    • What are the molecular mechanisms linking membrane potential changes to transcriptional responses?

  • Regulatory feedback loops:

    • Do developmental signals regulate kcnk9 activity post-translationally?

    • Is there a bidirectional relationship between kcnk9 activity and developmental gene expression?

    • How do cells interpret and respond to kcnk9-mediated changes in membrane potential?

Evolutionary and Comparative Aspects:

  • Functional divergence questions:

    • How have the roles of kcnk9 in development diverged between amphibians and mammals?

    • Do duplicated kcnk9 genes in X. laevis have subfunctionalized developmental roles?

    • Are there amphibian-specific functions of kcnk9 related to their unique life cycle?

  • Adaptive significance:

    • How does kcnk9 function relate to amphibian-specific developmental adaptations?

    • Does kcnk9 play a role in environmental responses during development?

    • Has kcnk9 function been shaped by specific selective pressures in amphibian evolution?

Research Approaches to Address These Questions:

Question CategoryMethodological ApproachExpected Insights
Expression patternsSingle-cell RNA-seq combined with spatial transcriptomicsComprehensive mapping of kcnk9 expression dynamics
Functional rolesCRISPR-Cas9 knockout combined with voltage imagingDirect visualization of bioelectric consequences of kcnk9 loss
Pathway interactionsPhosphoproteomic analysis after kcnk9 manipulationIdentification of signaling events downstream of channel activity
Evolutionary aspectsComparative functional analysis across multiple speciesUnderstanding of conserved versus divergent functions

Priority Research Areas:

  • Development of comprehensive expression maps for kcnk9 throughout Xenopus development

  • Generation and characterization of kcnk9 knockout or knockdown models

  • Investigation of molecular mechanisms linking kcnk9 activity to developmental gene expression

  • Analysis of potential subfunctionalization between duplicated kcnk9 genes

  • Integration of kcnk9 function into broader models of bioelectric control of development

Addressing these questions will significantly advance our understanding of bioelectric signaling in development and may reveal novel principles of morphogenetic control applicable across species .

What are common challenges in expressing functional Xenopus kcnk9 in heterologous systems?

Researchers often encounter challenges when expressing functional Xenopus kcnk9 in heterologous systems. Here are common problems and methodological solutions:

Expression Level Challenges:

  • Low expression efficiency:

    • Problem: Insufficient channel expression for detection or functional studies

    • Solutions:

      • Optimize codon usage for the expression system

      • Use strong promoters (CMV for mammalian cells, T7 for Xenopus oocytes)

      • Add Kozak consensus sequence before start codon

      • Incorporate 5' and 3' UTR elements that enhance translation

  • Toxicity from overexpression:

    • Problem: Cell death or growth inhibition due to excessive K+ conductance

    • Solutions:

      • Use inducible expression systems (tetracycline-regulated, etc.)

      • Reduce expression plasmid concentration

      • Consider co-expressing regulatory subunits that modulate channel activity

      • Use cell lines with appropriate compensation mechanisms

Protein Folding and Trafficking Issues:

  • Misfolding and aggregation:

    • Problem: Channel proteins fail to achieve proper conformation

    • Solutions:

      • Express at lower temperatures (30°C for mammalian cells, 15-18°C for Xenopus oocytes)

      • Add chaperone proteins or chemical chaperones (glycerol, DMSO at low concentrations)

      • Include molecular tags that enhance folding efficiency

      • Try fusion with well-expressed proteins like GFP

  • Intracellular retention:

    • Problem: Channels fail to reach plasma membrane

    • Solutions:

      • Add trafficking signals or remove retention signals

      • Co-express proteins that facilitate trafficking

      • Use trafficking enhancers like sodium butyrate

      • Verify with subcellular fractionation or imaging

Functional Measurement Difficulties:

  • Low signal-to-noise ratio:

    • Problem: K+ currents too small to measure reliably

    • Solutions:

      • Increase extracellular K+ concentration to enhance driving force

      • Use specific blockers of endogenous channels

      • Employ noise reduction techniques (P/n leak subtraction, capacitance compensation)

      • Consider patch configurations with better signal resolution (outside-out patches)

  • Interference from endogenous channels:

    • Problem: Native K+ channels obscure kcnk9 signals

    • Solutions:

      • Select expression systems with minimal background K+ currents

      • Use pharmacological blockers of endogenous channels

      • Perform experiments in the presence/absence of specific kcnk9 modulators

      • Subtract currents recorded from non-transfected cells

Experimental Protocol Optimization:

ChallengeDiagnostic SignOptimization StrategyValidation Method
Poor membrane targetingLow current despite high mRNA/DNAAdd fluorescent tag to visualize localizationConfocal microscopy
Protein degradationLow protein despite high mRNAAdd proteasome inhibitorsWestern blot time course
Functional interferenceUnexpected channel propertiesTest in multiple expression systemsComparative electrophysiology
Regulatory differencesChannel behaves differently than predictedExamine post-translational modificationsPhosphorylation site analysis

Expression System-Specific Considerations:

  • Xenopus oocytes:

    • Advantages: Native environment for Xenopus proteins, large size for recordings

    • Challenges: Endogenous K+ channels, seasonal variability in oocyte quality

    • Solutions: Use defolliculated oocytes, screen multiple batches, block endogenous channels

  • Mammalian cell lines (HEK293, CHO):

    • Advantages: Rapid growth, good membrane targeting

    • Challenges: Different post-translational modifications, endogenous channels

    • Solutions: Select low-passage cells, use stable cell lines, optimize transfection conditions

  • Insect cells (Sf9, High Five):

    • Advantages: High expression levels, eukaryotic processing

    • Challenges: Different membrane composition, growth temperature

    • Solutions: Optimize baculovirus titers, include trafficking signals

By systematically addressing these challenges, researchers can establish reliable heterologous expression systems for studying Xenopus kcnk9 function and regulation .

What controls are essential for validating kcnk9 channel activity in experimental systems?

Proper experimental controls are crucial for validating kcnk9 channel activity and ensuring reliable, interpretable results. Here's a comprehensive guide to essential controls for different experimental contexts:

Electrophysiological Studies:

  • Negative controls:

    • Non-transfected/non-injected cells to establish baseline conductance

    • Cells expressing non-functional kcnk9 mutants (pore mutations)

    • Expression of unrelated membrane proteins (e.g., GFP) at similar levels

  • Positive controls:

    • Well-characterized K+ channels with known properties

    • Mammalian kcnk9 with established electrophysiological signature

    • Application of known modifiers (activators or inhibitors) of kcnk9

  • Specificity controls:

    • Ionic selectivity verification by ion substitution experiments

    • Pharmacological profiling with specific and non-specific blockers

    • Removal of extracellular K+ to eliminate K+ currents

Expression Validation Controls:

  • Transcriptional controls:

    • qRT-PCR to verify mRNA expression levels

    • Northern blot to confirm transcript size and integrity

    • In situ hybridization to validate spatial expression patterns

  • Protein expression controls:

    • Western blotting to confirm protein size and expression level

    • Immunocytochemistry to verify subcellular localization

    • Surface biotinylation to quantify membrane expression

  • Functional tagging controls:

    • Verification that tags (GFP, epitope tags) don't alter channel function

    • Co-localization studies with membrane markers

    • Comparison of tagged and untagged versions of the channel

Control Matrix for Experimental Designs:

Experimental ApproachEssential Negative ControlsEssential Positive ControlsValidation Controls
Heterologous expressionNon-transfected cellsKnown K+ channelWestern blot for expression
ElectrophysiologyNa+-only solutionK+ ionophore applicationIon substitution experiments
Transgenic studiesGFP-only transgenic lineKnown K+ channel transgenicRT-PCR for expression level
Pharmacological studiesVehicle-only applicationKnown channel modulatorDose-response relationship
Mutagenesis studiesWild-type kcnk9Established mutant channelsProtein expression verification

Critical Controls for Specific Applications:

  • For biophysical characterization:

    • Temperature controls: Record at consistent temperatures or establish temperature-response relationships

    • pH controls: Buffer solutions precisely and test pH sensitivity systematically

    • Divalent cation controls: Define Ca2+ and Mg2+ concentrations and test sensitivity

  • For developmental studies:

    • Stage-matched wild-type controls

    • Transgenic lines expressing unrelated proteins at similar levels

    • Rescue experiments to confirm specificity of observed phenotypes

    • Heat-shock only controls for inducible systems

  • For protein interaction studies:

    • Appropriate non-interacting protein controls

    • Reciprocal co-immunoprecipitation

    • Competition experiments with excess untagged protein

    • In situ proximity ligation assays to confirm interactions in native context

Validation Strategy Flowchart:

Implementing these comprehensive controls ensures that observed effects can be confidently attributed to kcnk9 activity rather than experimental artifacts or non-specific effects. This approach builds a solid foundation for advancing understanding of this important potassium channel in Xenopus models .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.