Recombinant Xenopus laevis Potassium voltage-gated channel subfamily A member 2 (kcna2)

Shipped with Ice Packs
In Stock

Description

Role in Neurological Disorders

Mutations in KCNA2 are linked to developmental and epileptic encephalopathies (DEEs), hereditary spastic paraplegia, and episodic ataxia. Functional studies using recombinant kcna2 reveal two primary mutation types:

  • Loss-of-Function (LOF): Causes impaired repolarization, leading to neuronal hyperexcitability and seizures .

    • Example: c.881G>A (p.Arg294His) reduces current amplitudes by 90% .

  • Gain-of-Function (GOF): Channels remain open at resting potentials, paradoxically increasing network excitability and severe encephalopathy .

    • Example: c.765_773del induces permanent channel opening .

Table 2: Clinical Phenotypes Linked to kcna2 Mutations

Mutation TypeSeizure OnsetCognitive ImpactAssociated Conditions
LOF8–17 monthsMild–moderate IDEpilepsy, ataxia
GOFNeonatalSevere IDEpileptic encephalopathy, HSP

Functional Studies in Xenopus Oocytes

Recombinant kcna2 is a cornerstone for electrophysiological characterization:

  • Voltage-Clamp Analysis: Wild-type kcna2 produces slow-activating potassium currents (peak ~1.82 µA at +40 mV) .

  • Dominant-Negative Effects: Co-expressing mutant and wild-type subunits suppresses currents (e.g., c.765_773del reduces currents to 0.28 µA) .

  • Pathogenic Mechanisms:

    • LOF mutants (e.g., p.Pro407Ala) disrupt the PVP motif, abolishing ion conductance .

    • GOF mutants (e.g., p.Thr376Arg) shift voltage dependence, causing premature channel activation .

Therapeutic Insights

Targeted therapies leveraging recombinant kcna2 include:

  • 4-Aminopyridine (4-AP): Blocks GOF channels, restoring normal firing rates in vitro and improving seizures/ataxia in 9/11 patients .

  • Antisense Oligonucleotides (ASOs): Gapmer ASOs selectively degrade mutant mRNA (e.g., c.1220C>G), rescuing potassium currents in cortical neurons .

Table 3: Therapeutic Approaches Validated via Recombinant kcna2

TherapyMechanismEfficacy in Models
4-APK⁺ channel blockerSeizure freedom in 6/6
ASOsMutant mRNA degradationAP duration normalization

Research Applications

  • Disease Modeling: Used to replicate channelopathies in heterologous systems .

  • Drug Screening: Identifies compounds like retigabine to counteract dendritic arbor defects in SCN1B-linked epilepsy .

  • Network Excitability Studies: Clarifies how Kv1.2 dysfunction alters neuronal synchronization .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us, and we will prioritize its implementation.
Synonyms
kcna2; Potassium voltage-gated channel subfamily A member 2; Voltage-gated potassium channel subunit Kv1.2; xSHA2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-499
Protein Length
full length protein
Species
Xenopus laevis (African clawed frog)
Target Names
kcna2
Target Protein Sequence
MTVATGDLTDGSVGFAGHPQDSYDPEPDHECCERVVINISGLRFETQLKTLSQFPETLLG DPKKRMRYFDPLRNEYFFDRNRPSFDAILYFYQSGGRLRRPVNVPLDIFSEEIRFYELGE EAMEIFREDEGFIKEEERPLPDNEFQKQVWLLFEYPESSGPARIIAIISVTVILISIVSF CLETLPVFRDENEDMHGSGGNYYSYPNSTVRFQKSNTFTDPFFIVETLCIIWFSFEFLVR FLACPSKAVFFTNLMNIIDIVAIIPYFITLGTELAEKTEDGQQGQQAMSLAILRVIRLVR VFRIFKLSRHSKGLQILGQTLNASMRELGLLIFFLFIGVILFSSAVFFAEADERDSQFPS IPDAFWWAVVSMTTVGYGDMVPTTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRE TEGEEQAQYLQVTSCPKIPSSPDLQKSRSASTLSKSDYMEIQEGVNHSNEDFREKNLKTA NCTLGNTNYVNITKMLTDV
Uniprot No.

Target Background

Function

Recombinant Xenopus laevis Potassium voltage-gated channel subfamily A member 2 (KCNA2) is a voltage-gated potassium channel mediating transmembrane potassium transport in excitable membranes, primarily within the brain and central nervous system. Its function is crucial in preventing aberrant action potential firing and regulating neuronal output. KCNA2 forms tetrameric potassium-selective channels, facilitating potassium ion passage according to their electrochemical gradient. The channel transitions between open and closed conformations in response to transmembrane voltage changes. It can form both homotetrameric and heterotetrameric channels with other family members, with channel characteristics significantly influenced by the constituent alpha subunits. Cytoplasmic beta subunits modulate channel properties and regulate the alpha subunit's subcellular localization. In vivo, membranes likely contain a mixture of heteromeric potassium channel complexes, making it challenging to definitively assign currents observed in intact tissues to specific potassium channel family members. Homotetrameric KCNA2 forms a delayed-rectifier potassium channel, opening upon membrane depolarization and subsequently undergoing slow spontaneous closure. It regulates neuronal excitability and functions as a pacemaker in neuronal action potential regulation. Presynaptically, KCNA2-containing channels prevent hyperexcitability and aberrant action potential firing. Studies using KCNA2-selective toxins indicate that in Purkinje cells, subthreshold dendritic KCNA2 channels prevent spontaneous calcium spikes, suppressing dendritic hyperexcitability without impacting somatic action potential generation, playing a crucial role in motor coordination. Furthermore, KCNA2 is involved in long-term potentiation of neuronal excitability in the CA3 region of the hippocampus.

Database Links

UniGene: Xl.748

Protein Families
Potassium channel family, A (Shaker) (TC 1.A.1.2) subfamily, Kv1.2/KCNA2 sub-subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Detected in tadpole brain and spinal cord.

Q&A

What is KCNA2 and what is its role in neuronal function?

KCNA2 encodes the potassium channel KV1.2, which belongs to the delayed rectifier class of potassium channels enabling efficient neuronal repolarization following an action potential . Loss-of-function mutations predict hyperexcitable neuronal membranes and repetitive neuronal firing due to impaired repolarization, a hypothesis corroborated by the epileptic phenotype of the Kcna2 knock-out mouse . KV1.2 has been detected in a broad range of both excitatory and inhibitory neurons, making its physiological role complex and context-dependent .

Why is Xenopus laevis used as a model system for KCNA2 studies?

The Xenopus laevis oocyte expression system has become a standard for ion channel research due to several advantages:

  • It allows controlled expression of specific channel proteins foreign to the amphibian oocyte

  • The system permits selection for simultaneous expression of multiple proteins

  • Over 8,000 published works describe experimental approaches using this model, including techniques such as two-electrode voltage clamp (TEVC), patch clamp, and cut-open oocyte voltage clamp

  • The oocytes provide a relatively simple and inexpensive approach to study the additive effects of ion channel subtypes on action potential generation

  • The large size of oocytes facilitates microinjection of RNA and electrophysiological recordings

How are Xenopus oocytes prepared for KCNA2 expression studies?

Preparation of Xenopus oocytes for KCNA2 expression typically follows these steps:

  • Oocytes are obtained from Xenopus laevis frogs (often from specialized facilities like the Institute of Physiology I, Tübingen)

  • RNA encoding KCNA2 (wild-type or mutant variants) is injected into the oocytes

  • Injected oocytes are incubated at approximately 17°C for 2-4 days to allow for channel expression

  • Prior to recording, oocytes are placed in a saline solution typically containing: 98 mM NaCl, 2 mM KCl, 2.8 mM MgCl2, 0.2 mM CaCl2, and 5 mM HEPES (pH 7.4)

  • Two-electrode voltage-clamp or other electrophysiological techniques are then used to characterize channel function

How should researchers design experiments to compare wild-type and mutant KCNA2 channels in Xenopus oocytes?

Designing robust comparative experiments requires careful consideration of multiple factors:

  • Expression control: Standardize RNA quality, concentration, and injection volume for consistent expression levels.

  • Paired experiments: Compare wild-type and mutant channels in oocytes from the same batch to minimize variability.

  • Key parameters to measure:

    • Current amplitude at different voltages

    • Voltage-dependence of activation (activation curves)

    • Activation and deactivation kinetics

    • Resting membrane potential

  • Co-expression studies: When studying mutations with dominant-negative effects, co-express mutant and wild-type channels at different ratios to model heterozygous conditions .

  • Protocol example: As demonstrated in study , use automated two-microelectrode voltage clamp to measure:

    • Current amplitudes before and after pharmacological intervention

    • Shifts in voltage-dependence of channel activation

    • Effects on resting membrane potential

  • Cross-validation: Validate findings in multiple systems (e.g., CHO cells or neuronal cultures) to ensure physiological relevance .

What are the optimal electrophysiological protocols for studying KCNA2 function in Xenopus oocytes?

Based on published research, the following protocols are recommended:

  • Standard voltage-clamp protocol:

    • Hold at -80 mV

    • Apply voltage steps from -100 to +60 mV in 10 mV increments

    • Record resulting currents to generate I-V relationships and activation curves

  • Action potential recording:

    • Use loose-clamp electronics as described by Corbin-Leftwich et al. (see Fig. 1A and B in study )

    • Co-express Na+ channels (e.g., Nav1.4 α and β subunits) with KCNA2

    • Apply brief (1-ms) depolarizing pulses to elicit all-or-none APs

    • Vary pulse amplitude to determine threshold potential

  • Pharmacological interventions:

    • For 4-AP studies: Apply the compound in increasing concentrations (0.1-10 mM) to establish dose-response relationships

    • Record before, during, and after drug application to capture acute effects and potential recovery

  • Ion substitution experiments:

    • Substitute NaCl and KCl with equivalent amounts of KCl (for NaCl), RbCl, or CsCl to assess ion selectivity

How do KCNA2 mutations affect channel biophysics, and how can these effects be measured?

KCNA2 mutations can alter channel function through distinct mechanisms, producing characteristic biophysical signatures:

Mutation TypeBiophysical EffectMeasurement ApproachExamples from Studies
Loss-of-function (LOF)Reduced current amplitudeCompare peak currents at different voltagesVarious mutations causing epileptic encephalopathy
Gain-of-function (GOF)Hyperpolarizing shift in activationMeasure V₁/₂ of activation curvesR297Q, L298F causing permanently open channels
Mixed (GOF+LOF)Both reduced current and shifted activationCombined analysis of amplitude and gatingp.(Leu328Val), p.(Thr374Ala)
Dominant-negativeSuppresses wild-type channel functionCo-expression with wild-type channelp.255_257del causing episodic ataxia

Key experimental approaches include:

  • Comparing voltage-dependent activation curves between wild-type and mutant channels

  • Measuring shifts in half-activation voltage (V₁/₂)

  • Assessing changes in activation/deactivation kinetics

  • Measuring resting membrane potential in expressing cells

  • Testing pharmacological sensitivity (e.g., to 4-AP)

How can researchers establish reliable action potential recordings in Xenopus oocytes expressing KCNA2?

Creating a reliable action potential model in Xenopus oocytes requires specific methodological considerations:

  • Channel co-expression requirements:

    • Expression of both Na+ and K+ channels is necessary for generating APs

    • For KCNA2 studies, co-express with a voltage-gated Na+ channel (e.g., Nav1.4 with α and β subunits)

    • Ensure sufficiently high expression levels of both channel types

  • Recording configuration:

    • Use loose-clamp electronics as described in Corbin-Leftwich et al. (2018)

    • The resistor-diode device allows depolarization of the membrane but not its repolarization

    • This configuration permits detection of all-or-none regenerative electrical activity

  • Stimulation protocol:

    • Apply brief (1-ms) depolarizing pulses

    • Increase pulse amplitude until threshold is reached

    • Verify all-or-none nature of the response (suprathreshold stimuli should produce consistent AP amplitude)

  • AP characteristics verification:

    • Successful APs should show:

      • Quick rising phase (Na+ channel activation)

      • Peak at approximately +20 mV

      • Rapid repolarization (K+ channel activation)

      • Often an afterhyperpolarization phase

  • Control experiments:

    • Record from uninjected oocytes to confirm they produce only slow, non-undershoot electrotonic responses

    • Verify Na+ current dependency by blocking with TTX

    • Confirm K+ current contribution by applying 4-AP

What approaches can be used to study the effects of 4-aminopyridine (4-AP) on wild-type and mutant KCNA2 channels?

Research on 4-AP effects on KCNA2 channels employs multiple complementary approaches:

  • Voltage-clamp studies in Xenopus oocytes:

    • Apply 4-AP while recording KCNA2 currents at different voltages

    • Measure changes in:

      • Current amplitude (typically reduced by 4-AP)

      • Voltage-dependence of activation (typically shifted in depolarizing direction)

    • Construct dose-response curves to determine potency

  • Mammalian cell validation:

    • Repeat key experiments in CHO cells expressing wild-type or mutant channels

    • Perform dose-response studies to compare 4-AP sensitivity between expression systems

    • Measure effects on resting membrane potential

  • Neuronal model systems:

    • Transduce primary hippocampal cultures with wild-type or mutant KCNA2

    • Assess how 4-AP affects:

      • Firing frequency

      • Resting membrane potential

      • Current threshold for action potential generation

      • Action potential waveform

  • Mutation-specific effects:

    • For GOF mutations: Test if 4-AP can normalize the hyperpolarized resting potential

    • For LOF mutations: Assess if 4-AP exacerbates the phenotype

    • For mutations with mixed effects (e.g., p.(Leu328Val), p.(Thr374Ala)): Test effects when co-expressed with wild-type channels

Research findings show that 4-AP (0.1 mM) can reverse the firing deficit in neurons expressing mutant KCNA2 p.(Arg297Gln) channels, suggesting therapeutic potential for certain KCNA2-related disorders .

How do co-expression studies of KCNA2 with other channel subunits inform our understanding of channel function?

Co-expression studies provide crucial insights into channel interactions and physiological function:

  • Heteromeric channel formation:

    • When KCNA2 mutants (p.(Leu328Val), p.(Thr374Ala)) that were not blocked by 4-AP alone were co-expressed with wild-type KV1.1 or KV1.2 channels, a clear blocking effect of 4-AP was observed

    • This demonstrates that subunit composition can dramatically alter pharmacological sensitivity

  • Dominant-negative effects:

    • Co-expression of certain KCNA2 mutants with wild-type channels can reveal dominant-negative effects

    • This models the heterozygous state in patients with de novo mutations

    • Activation curves shift to more depolarized potentials after application of 4-AP when mutants are co-expressed with wild-type channels

  • Action potential generation:

    • Co-expression of Na+ and K+ channels is necessary for AP generation in oocytes

    • The specific properties of the AP depend on the relative expression levels and types of channels

    • Different K+ channel subtypes modulate excitability in distinct ways

  • Experimental considerations:

    • Control RNA ratios carefully when co-injecting multiple channel types

    • Verify expression of all components through electrophysiological recording

    • Consider potential competition for translation machinery that may affect expression levels

How should researchers analyze voltage-clamp data from KCNA2 studies in Xenopus oocytes?

Robust analysis of KCNA2 voltage-clamp data requires systematic approaches:

  • Current-voltage (I-V) relationships:

    • Plot peak current amplitude against test potential

    • Compare I-V curves before and after interventions (e.g., 4-AP application)

    • Normalize to maximum current or cell capacitance when comparing between conditions

  • Activation curve analysis:

    • Convert current data to conductance using the equation G = I/(V-Eₖ), where Eₖ is the potassium equilibrium potential

    • Normalize to maximum conductance (G/Gmax)

    • Fit with Boltzmann function: G/Gmax = 1/(1+exp[(V₁/₂-V)/k])

    • Extract V₁/₂ (half-activation voltage) and k (slope factor)

    • Compare these parameters between wild-type and mutants

  • Kinetic analysis:

    • Fit current traces with exponential functions to determine activation and deactivation time constants

    • Plot time constants against voltage

    • Compare kinetic parameters between conditions

  • Statistical approaches:

    • Use appropriate statistical tests (e.g., paired t-test for before/after comparisons)

    • Report mean ± SEM or SD

    • Include sufficient biological replicates (oocytes from different batches)

  • Common findings to interpret:

    • Hyperpolarizing shifts in activation curves suggest gain-of-function

    • Depolarizing shifts in activation curves after 4-AP application indicate channel block

    • Reduced current amplitude suggests loss-of-function or channel block

What are the challenges in translating findings from Xenopus oocyte KCNA2 studies to human neurological disorders?

Several challenges must be addressed when extrapolating from oocyte studies to human conditions:

  • Expression system differences:

    • Higher concentrations of 4-AP are often needed to block KV1.2 channels in Xenopus oocytes compared to mammalian systems

    • Post-translational modifications may differ between amphibian oocytes and human neurons

    • Membrane composition and auxiliary proteins differ between systems

  • Complexity of neuronal networks:

    • Single-cell models cannot capture network effects of KCNA2 dysfunction

    • KCNA2 is expressed in both excitatory and inhibitory neurons, making circuit-level effects difficult to predict

    • Compensatory mechanisms may operate in vivo but not in expression systems

  • Developmental considerations:

    • KCNA2-related disorders often have age-dependent manifestations

    • Oocyte models cannot capture developmental aspects of channel expression and function

    • Temporal dynamics of gene expression are absent in heterologous systems

  • Validation approaches:

    • Cross-validate findings in multiple systems (oocytes, mammalian cell lines, neuronal cultures)

    • Consider gene-targeted mouse models for in vivo validation

    • Correlate functional findings with clinical phenotypes in patients with characterized mutations

  • Therapeutic implications:

    • Dose requirements determined in oocytes may not translate directly to clinical applications

    • Pharmacokinetic and blood-brain barrier considerations are absent in oocyte models

    • Off-target effects may differ between systems

How can researchers reconcile contradictory findings between different experimental systems studying KCNA2?

Addressing contradictory findings requires systematic investigation and methodological considerations:

  • Multi-system validation approach:

    • Test key findings across multiple expression systems (Xenopus oocytes, mammalian cell lines, neuronal cultures)

    • Use consistent experimental protocols and analysis methods across systems

    • Identify system-specific versus consistent findings

  • Concentration and dose adjustments:

    • Determine relative sensitivity of different systems to pharmacological agents

    • Establish concentration-response relationships in each system

    • Normalize effects to maximum response rather than absolute concentration

  • Expression level considerations:

    • Control for variation in expression levels between systems

    • Use quantitative measures (e.g., maximum current density) to normalize data

    • Consider effects of different channel subunit stoichiometries

  • Molecular dynamics modeling:

    • Use structural modeling to predict and explain functional data

    • Molecular modeling can help explain repositioning of critical residues in the voltage-sensing domain, as seen with the p.255_257del mutation

    • Reconcile functional data with structural insights

  • Experimental design refinements:

    • Standardize recording solutions and experimental conditions

    • Consider temperature effects (oocyte recordings typically at room temperature vs. 37°C for mammalian systems)

    • Control for potential effects of endogenous channels in each expression system

How do functional studies of KCNA2 in Xenopus oocytes inform precision medicine approaches?

Oocyte expression studies provide critical insights for personalized therapeutic approaches:

  • Mutation classification for treatment stratification:

    • Functional studies in oocytes help categorize mutations as LOF, GOF, or mixed

    • This classification guides therapeutic strategy:

      • LOF mutations may benefit from potassium channel openers

      • GOF mutations may respond to channel blockers like 4-AP

  • Pharmacological response prediction:

    • 4-AP inhibits wild-type and several mutant channels (p.(Glu157Lys), p.(Arg297Gln), p.(Leu298Phe), p.(Leu290Arg) and p.(Leu293His)) by:

      • Reducing current amplitudes

      • Shifting voltage-dependence of activation in a depolarizing direction

    • These findings predict which patient genotypes might respond to 4-AP therapy

  • Dose optimization guidance:

    • Dose-response studies in oocytes provide starting points for clinical dosing

    • Different mutations show varying sensitivity to channel modulators

    • Co-expression studies model heterozygous patient conditions more accurately

  • Mechanism-based combination therapies:

    • Understanding how mutations affect channel function at the molecular level enables rational combination approaches

    • For mutations with mixed effects, targeted combinations addressing both aspects of dysfunction may be beneficial

  • Therapeutic validation data:

    • Application of 0.1 mM 4-AP to neurons expressing mutant p.(Arg297Gln) channels reversed observed firing deficits

    • This provides proof-of-concept for translation to clinical applications

The Xenopus oocyte system offers several advantages for KCNA2-targeted drug discovery:

  • High-throughput screening optimization:

    • Automate two-electrode voltage clamp recordings for screening compound libraries

    • Establish stable readouts (e.g., shift in activation voltage) for hit identification

    • Use fluorescence-based assays as secondary screens for potential hits

  • Expression of human mutation panel:

    • Create a comprehensive panel of clinically relevant KCNA2 mutations

    • Compare drug effects across different mutation types

    • Identify compounds with mutation-specific versus broadly effective profiles

  • Co-expression models:

    • Express KCNA2 with relevant auxiliary subunits and interacting proteins

    • Create more physiologically relevant testing platforms

    • Test compounds in heteromeric channel configurations

  • Action potential model refinement:

    • Optimize the action potential model described by Corbin-Leftwich et al.

    • Use AP parameters as functional readouts for compound screening

    • Identify compounds that normalize AP characteristics in models expressing mutant channels

  • Translational pathway:

    • Validate hits in mammalian cell lines and neuronal cultures

    • Correlate in vitro potency with in vivo efficacy in animal models

    • Establish PK/PD relationships to guide clinical trial design

  • Combination approaches:

    • Test synergistic effects of compound combinations

    • Screen for compounds that can enhance effects of existing therapies like 4-AP

    • Develop rationally designed combination therapies based on mechanistic understanding

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.