Recombinant Xenopus laevis Potassium voltage-gated channel subfamily KQT member 1 (kcnq1)

Shipped with Ice Packs
In Stock

Description

Research Applications

Recombinant Xenopus KCNQ1 is widely used in electrophysiological and structural studies:

  • Channel Trafficking and Regulation: Coexpression with KCNE1 in Xenopus oocytes reveals how accessory subunits modulate channel kinetics and membrane localization . For example, serum/glucocorticoid-regulated kinase 1 (SGK1) enhances KCNQ1/KCNE1 currents by promoting vesicular recycling to the plasma membrane .

  • Structural Insights: Cryo-EM and NMR studies using recombinant KCNQ1 have resolved its voltage-sensing domain (VSD) in intermediate and activated states, critical for understanding conformational changes during gating .

  • Drug Interactions: The protein serves as a template for screening compounds targeting cardiac arrhythmias or epithelial transport disorders .

Functional and Biophysical Findings

Key discoveries facilitated by recombinant Xenopus KCNQ1 include:

  • Stoichiometric Flexibility: Coassembly with KCNE1 subunits occurs post-translationally, with variable ratios (4:2 to 4:4) influencing activation kinetics and current density .

  • Voltage-Sensing Dynamics: The VSD adopts distinct intermediate (IO) and activated (AO) states, stabilized by interactions between residues E2-R4 and F0-Q3 .

  • Pathogenic Mutations: Dominant-negative variants like G314S disrupt channel function by reducing current density, as shown in heterologous expression systems .

Comparative Analysis with Mammalian Homologs

While Xenopus KCNQ1 shares ~80% sequence identity with human KCNQ1, differences in regulatory domains affect drug binding and subunit interactions . For example:

FeatureXenopus KCNQ1Human KCNQ1
PIP2 Binding SiteLess sensitive to phosphatidylinositol-4,5-bisphosphate (PIP2) modulationPIP2 binding induces pore dilation
KCNE1 ModulationSlower deactivation kineticsStronger current amplification

Technical Considerations

  • Reconstitution: Optimal activity requires reconstitution in liposomes or planar lipid bilayers, with glycerol (5–50%) enhancing stability .

  • Limitations: The partial sequence lacks the C-terminal domain necessary for calmodulin binding, limiting studies on calcium-dependent regulation .

Future Directions

Current efforts focus on engineering full-length Xenopus KCNQ1 for cryo-EM studies and high-throughput drug screening . Integrating CRISPR-edited Xenopus models with recombinant protein assays will further clarify genotype-phenotype relationships in long QT syndrome .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
It is recommended to briefly centrifuge the vial before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by factors including storage conditions, buffer components, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is decided during production. If you have a specific tag requirement, please inform us, and we will prioritize its development if feasible.
Synonyms
kcnq1; kvlqt1; Potassium voltage-gated channel subfamily KQT member 1; IKs producing slow voltage-gated potassium channel subunit alpha xKvLQT1; KQT-like 1; Voltage-gated potassium channel subunit Kv7.1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-377
Protein Length
full length protein
Species
Xenopus laevis (African clawed frog)
Target Names
kcnq1
Target Protein Sequence
MNENAINSLYEAIPLPQDGSSNGQRQEDRQANSFELKRETLVATDPPRPTINLDPRVSIY SGRRPLLSRTNIQGRVYNFLERPTGWKCFVYHFTVFLIVLICLIFSVLSTIQQYNNLATE TLFWMEIVLVVFFGAEYVVRLWSAGCRSKYVGVWGRLRFARKPISVIDLIVVVASVIVLC VGSNGQVFATSAIRGIRFLQILRMLHVDRQGGTWRLLGSVVFIHRQELITTLYIGFLGLI FSSYFVYLAEKDAIDSSGEYQFGSYADALWWGVVTVTTIGYGDKVPQTWIGKTIASCFSV FAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAASLIQTAWRCYAAENPDSATWKI YIRKQSRNHHIMSPSPK
Uniprot No.

Target Background

Function
KCNQ1, a potassium channel, plays a crucial role in various tissues, including the heart, inner ear, stomach, and colon. It interacts with KCNE beta subunits, which modulate current kinetics. KCNQ1 induces a voltage-dependent potassium-selective outward current with rapid activation and slow deactivation. Additionally, it promotes a delayed voltage-activated potassium current exhibiting outward rectification characteristics. During beta-adrenergic receptor stimulation, KCNQ1 participates in cardiac repolarization by associating with KCNE1 to form the I(Ks) cardiac potassium current, increasing the amplitude and slowing down the activation kinetics of outward potassium current I(Ks). When associated with KCNE3, it forms the potassium channel essential for cyclic AMP-stimulated intestinal chloride ion secretion. Complex formation with KCNE2 results in a heterooligomer complex leading to currents with seemingly instantaneous activation, rapid deactivation, and a linear current-voltage relationship, while also decreasing the amplitude of the outward current. In association with KCNE4, it inhibits voltage-gated potassium channel activity. Lastly, the complex with KCNE5 only conducts current under strong and sustained depolarization.
Gene References Into Functions
  1. This study describes a physiological form of KCNQ1 characterized by depolarized voltage sensors with a closed pore in the absence of PIP2, and reveals a regulatory interaction between CaM and KCNQ1 that may explain CaM-mediated Long QT Syndrome. PMID: 28575668
  2. KCNE1/KCNQ1 was expressed in Xenopus oocytes both with and without beta-catenin. Confocal microscopy demonstrated that beta-catenin enhanced the abundance of KCNE1/KCNQ1 protein in the cell membrane. PMID: 22583083
  3. The findings indicate that AMPK inhibits KCNQ1 activity by promoting Nedd4-2-dependent channel ubiquitination and retrieval from the plasma membrane. PMID: 20861072
  4. S1 restricts S4 within the voltage sensor domain of Kv7.1 K+ channels. PMID: 18398461
  5. This research characterizes a novel component of the early bioelectrical circuit: the potassium channel KCNQ1 and its accessory subunit KCNE1. PMID: 18453744
  6. Slow delayed rectifier potassium currents mediated by mutant KCNQ1(Y111C) or KCNQ1(L114P) are paradoxically reduced by serum- and glucocorticoid-inducible kinase 1. PMID: 19008479
  7. Phenylboronic acid (PBA) activates KCNQ1/KCNE1 complexes. PMID: 19156197

Show More

Hide All

Database Links

KEGG: xla:373746

UniGene: Xl.21509

Protein Families
Potassium channel family, KQT (TC 1.A.1.15) subfamily, Kv7.1/KCNQ1 sub-subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cytoplasmic vesicle membrane. Membrane raft. Endoplasmic reticulum. Basolateral cell membrane.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.