Recombinant Xenopus laevis Probable E3 ubiquitin-protein ligase RNF217 (rnf217)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Xenopus laevis Probable E3 Ubiquitin-Protein Ligase RNF217 (rnf217) is a protein that functions as an E3 ubiquitin ligase . E3 ubiquitin ligases are enzymes that facilitate the transfer of ubiquitin from an E2 ubiquitin-conjugating enzyme to a substrate protein, thus marking the substrate for degradation or altering its function . RNF217 participates in various biological pathways through its ligase activity, ubiquitin conjugating enzyme binding, and ubiquitin protein ligase activity .

Structure and Characteristics

RNF217 contains two RING finger domains, which are linked by an in-between-RING fingers (IBR) motif . RING finger domains are known to mediate protein-protein interactions and are crucial for the E3 ubiquitin ligase activity . The human RNF217 protein consists of 284 amino acids, resulting in a molecular mass of approximately 30 kDa . Sequence comparisons show that RNF217 is highly conserved across species . For example, human and mouse RNF217 share 98.6% amino acid identity .

Expression and Localization

Expression of rmnd5, the Xenopus laevis ortholog of RNF217, is notable in neuronal ectoderm, prospective brain, eyes, and ciliated cells of the skin . During the development of Xenopus laevis embryos, rmnd5 exhibits strong maternal contribution, with detectable transcripts in early developmental stages . Later in development, expression becomes mainly restricted to head structures, marking neural tissues and derivatives, with strong expression in the eyes and the prosencephalon .

Function

  • E3 Ubiquitin Ligase Activity: Xenopus laevis Rmnd5 demonstrates E3 ligase activity, as evidenced by in vitro polyubiquitination assays .

  • Iron Homeostasis: RNF217 regulates iron homeostasis by mediating the degradation of ferroportin (FPN), the only known cellular iron exporter .

  • Interaction with HAX1: RNF217 interacts with the anti-apoptotic protein HAX1, which suggests a role in apoptosis signaling .

RNF217 in Iron Homeostasis

RNF217 functions as an E3 ubiquitin ligase that mediates the degradation of FPN and regulates iron homeostasis . Rnf217 expression is upregulated by Tet1-mediated demethylation . The Tet1-RNF217-FPN axis regulates iron homeostasis, offering potential therapeutic targets for FPN-related diseases .

Involvement in Disease

While RNF217 is not frequently mutated in hematologic malignancies, it is a frequent target for copy number alterations in solid tumors . RNF213, a related E3 ubiquitin ligase, is associated with moyamoya disease, a rare cerebrovascular disease .

Related Proteins and Interactions

ProteinFunction
MUL1B, UBE2E2ubiquitin-protein transferase activity
Car8, PHF13zinc ion binding
RNF180, RNF149ubiquitin protein ligase activity
UBE4B, TRIM2ligase activity
ARIH1, DCUN1D3ubiquitin conjugating enzyme binding
HAX1Anti-apoptotic protein, interacts with RNF217
ECM2626S proteasome-binding protein, interacts with RNF217

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
rnf217; E3 ubiquitin-protein ligase RNF217; RING finger protein 217
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-282
Protein Length
full length protein
Species
Xenopus laevis (African clawed frog)
Target Names
rnf217
Target Protein Sequence
MSCRVCLEDRSIKPLPCCKKPVCDECLKRYLSSQVQLGQAEIQCPITECNKHLDESTILY SLPHDDIIKYKYFLELSRMDSSTKPCPQCKHFTTFKRKTHIPNPTKSENKLKIQCPSCQF IWCFRCHAPWHEGVNCREYKKGDKLLRHWANEIEHGQRNAQKCPRCKVHIQRTEGCDHMT CSQCNTNFCYRCGERYRQLRFFGDHTSNLSIFGCKYRYLPERPHVRRLVRGSVCAGKLLI APLLIVLGLVLGALAVVIGLFGLPIYCLCKKQRKRTRTGMPW
Uniprot No.

Target Background

Function

RNF217 is an E3 ubiquitin-protein ligase that accepts ubiquitin from E2 ubiquitin-conjugating enzymes via a thioester bond and directly transfers it to target substrates. It mediates the degradation of ferroportin/SLC40A1, an iron exporter, thereby regulating iron homeostasis.

Database Links

KEGG: xla:734643

UniGene: Xl.53060

Protein Families
RBR family, RNF217 subfamily
Subcellular Location
Cytoplasm. Membrane; Single-pass membrane protein.

Q&A

What is the function of RNF217 in Xenopus laevis?

RNF217 functions as an E3 ubiquitin ligase that plays a critical role in iron homeostasis. Its primary characterized activity is mediating the degradation of ferroportin (FPN), the only known cellular iron exporter, thereby regulating intracellular and systemic iron levels . In Xenopus laevis, RNF217 is part of a well-conserved pathway for iron regulation that exists across vertebrate species. Research indicates that RNF217 is expressed in multiple tissues, with the L subgenome variant appearing to be the predominant form in Xenopus laevis .

Why use Xenopus laevis as a model for studying RNF217 instead of other organisms?

Xenopus laevis offers several significant advantages as a model system for studying RNF217:

  • Large oocytes and embryos that facilitate biochemical analyses and microinjection experiments

  • Well-characterized developmental stages with a new open-access resource of illustrations available on Xenbase

  • Relatively large growth cones (10-30 μm in diameter) for studying cellular processes

  • External developmental environment free of maternal influence allowing easy experimental access

  • Availability of comprehensive genomic and proteomic resources through databases like Xenbase

  • Established protocols for gene manipulation via morpholino knockdown or mRNA overexpression

  • Cost-effective experimental platform compared to mammalian systems

The quasi-tetraploid nature of Xenopus laevis genome provides both challenges and opportunities for studying gene function, as duplicate gene copies may have undergone subfunctionalization .

What are the available protein sequence resources for Xenopus laevis RNF217?

According to Xenbase, multiple protein sequence models exist for Xenopus laevis RNF217:

Models:

SourceVersionModelSpecies
NCBI10.1XBmRNA43577X. laevis.L
Xenbase9.2rna94051X. laevis.L
JGI9.1Xelaev18027005mX. laevis.L
JGI6.0XeXenL6RMv10039401mX. laevis.L

NCBI Proteins:

AccessionSpeciesSource
AAH99015X. laevis.LNCBI Protein
NP_001089586X. laevis.LRefSeq
OCT80190-94X. laevis.LNCBI Protein

UniProt Proteins:

AccessionSpeciesSource
Q4KLT0 (InterPro)X. laevis.LSwiss-Prot

These resources provide crucial reference sequences for designing experiments involving RNF217 .

How can I express recombinant Xenopus laevis RNF217 in heterologous systems?

For successful expression of recombinant Xenopus laevis RNF217, consider the following methodological approaches:

Bacterial Expression System:

  • Clone the full-length RNF217 cDNA into an expression vector such as pET30a with an N-terminal His-tag for purification

  • Express in E. coli C41 cells, which are optimized for membrane and toxic protein expression

  • Purify using Nickel-Sepharose chromatography

  • Dialyze overnight against a buffer containing 25 mM Hepes pH 7.8, 250 mM NaCl, 5 mM imidazole, 5% glycerol, 7.5 mM MgCl₂, 1 mM DTT, and 1 mM EDTA

Baculovirus Expression System:

  • Clone RNF217 cDNA into pFastBac1 vector

  • Express using the Bac-to-Bac expression system (Invitrogen)

  • This approach has been successful for other Xenopus proteins like Yap

Xenopus Oocyte Expression:

  • Prepare a cDNA bank in plasmid pBR322 using Poly-A+ mRNA from Xenopus laevis oocytes

  • Select clones containing sequences specific for RNF217

  • Use the clones as templates for in vitro transcription to generate capped mRNA

  • Microinject the mRNA into Xenopus oocytes for protein expression

The choice of expression system depends on the specific research needs, with bacterial systems offering high yield but potentially limited post-translational modifications, whereas the baculovirus system better preserves eukaryotic protein processing.

What methods are effective for studying RNF217 interactions with ferroportin in Xenopus?

Several complementary approaches can be employed to study RNF217-ferroportin interactions:

Co-immunoprecipitation:

  • Express epitope-tagged versions of RNF217 and ferroportin in Xenopus oocytes or cell lines

  • Prepare cell lysates in a buffer containing 20 mM Tris-HCl pH 7.5, 150 mM NaCl, 1% NP-40, 5 mM EDTA with protease inhibitors

  • Immunoprecipitate with antibodies against either protein

  • Analyze precipitated complexes by western blotting

Ubiquitination Assays:

  • Co-express RNF217, ferroportin, and HA-tagged ubiquitin in Xenopus oocytes

  • Immunoprecipitate ferroportin and detect ubiquitination using anti-HA antibodies

  • Analyze ubiquitination patterns by western blotting to determine mono- vs. poly-ubiquitination

Protein Stability Assays:

  • Express ferroportin in the presence or absence of RNF217

  • Treat with cycloheximide to inhibit protein synthesis

  • Collect samples at different time points and analyze ferroportin levels by western blotting

  • Compare ferroportin half-life under different conditions

Functional Iron Export Assays:

  • Express ferroportin with or without RNF217 in Xenopus oocytes

  • Load oocytes with ⁵⁵Fe

  • Measure ⁵⁵Fe efflux over time

  • Compare efflux rates to determine the functional impact of RNF217 on ferroportin activity

These methods provide complementary data on the physical interaction, enzymatic modification, and functional consequences of RNF217 activity on ferroportin.

How can genome editing techniques be applied to study RNF217 function in Xenopus laevis?

CRISPR/Cas9 genome editing in Xenopus laevis provides powerful tools for studying RNF217 function:

CRISPR/Cas9 Gene Knockout Strategy:

  • Design sgRNAs targeting conserved regions of the RNF217 coding sequence

  • Synthesize sgRNAs using in vitro transcription

  • Microinject Cas9 protein (or mRNA) along with sgRNAs into one-cell stage embryos

  • Include a fluorescent tracer (dextran fluorescein lysine) to verify injection success

  • Screen F0 embryos for mutations using T7 endonuclease assay or direct sequencing

  • Raise mosaic F0 animals to adulthood and screen for germline transmission

Tissue-Specific Knockouts:
For studying RNF217 in specific tissues (e.g., liver for iron metabolism studies):

  • Use tissue-specific promoters (e.g., transthyretin for liver) to drive Cas9 expression

  • Co-inject with ubiquitously expressed sgRNAs

  • Analyze phenotypes in the targeted tissues

Alternative Morpholino Approach:
If CRISPR is technically challenging:

  • Design translation-blocking or splice-blocking morpholinos targeting RNF217 mRNA

  • Inject 1-2 pmol of morpholino into one-cell stage embryos

  • Include control morpholinos in parallel experiments

  • Validate knockdown efficiency by western blotting

The "Trim-Away" technique can also be used for acute protein depletion:

  • Co-inject recombinant hTRIM21 and anti-RNF217 antibodies

  • This induces rapid degradation of the target protein

  • Provides temporal control over protein depletion

Genome editing approaches are particularly valuable for studying the physiological roles of RNF217 in iron homeostasis during development and in adult tissues.

What approaches should be used to characterize the E3 ubiquitin ligase activity of Xenopus laevis RNF217?

Comprehensive characterization of RNF217's E3 ligase activity requires several biochemical approaches:

In Vitro Ubiquitination Assays:

  • Purify recombinant His-tagged RNF217 from bacterial or baculovirus expression systems

  • Combine with E1, E2 enzymes, ATP, and ubiquitin in reaction buffer

  • Add purified substrate protein (e.g., ferroportin)

  • Incubate at 30°C for 1-2 hours

  • Analyze ubiquitination by western blotting with anti-ubiquitin antibodies

  • Test multiple E2 enzymes to identify the specific E2 that cooperates with RNF217

E2 Screening:
Test RNF217 activity with a panel of E2 enzymes to identify functional partners:

E2 EnzymeFamilyActivity with RNF217
UBE2D1-4UBC4/5To be determined
UBE2E1-3UBC9To be determined
UBE2L3UBCH7To be determined
UBE2NUBC13To be determined

Structural Domain Analysis:

  • Generate truncation or point mutation variants of RNF217

  • Test each variant in ubiquitination assays

  • Map essential domains for E2 binding, substrate recognition, and catalytic activity

  • Focus on conserved RING finger domain mutations that should abolish E3 ligase activity

Mass Spectrometry Analysis:

  • Perform in vitro ubiquitination reactions with RNF217 and putative substrates

  • Digest proteins with trypsin

  • Analyze by tandem mass spectrometry to identify:

    • Specific lysine residues modified on substrates

    • Types of ubiquitin linkages (K48, K63, etc.)

    • Extent of mono- vs. poly-ubiquitination

These comprehensive approaches will determine if RNF217 functions as a bona fide E3 ligase in Xenopus laevis and identify its substrate specificity and ubiquitin chain preferences.

How does RNF217 expression correlate with iron status in Xenopus laevis tissues?

To investigate the relationship between RNF217 expression and iron status:

Tissue-Specific Expression Analysis:

  • Collect tissues from adult Xenopus (liver, intestine, spleen, brain, kidney)

  • Extract RNA and perform qRT-PCR for RNF217 mRNA quantification

  • Extract protein and perform western blotting for RNF217 protein levels

  • Compare expression patterns across tissues with known iron storage/utilization roles

Iron Manipulation Studies:

  • Maintain tadpoles or adult frogs on iron-deficient, normal, or iron-overloaded diets

  • Alternatively, inject iron dextran or iron chelators (deferiprone)

  • After treatment periods (24h, 48h, 1 week), collect tissues

  • Analyze RNF217 mRNA and protein expression

  • Measure tissue iron content using ferrozine assay or Prussian blue staining

Epigenetic Regulation Analysis:
Given that RNF217 expression is regulated by Tet1-mediated demethylation in mammals:

  • Perform bisulfite sequencing of the RNF217 promoter region under different iron conditions

  • Analyze histone modifications at the RNF217 locus using ChIP-qPCR

  • Test the effect of 5-azacytidine (demethylating agent) on RNF217 expression

Developmental Expression Profile:

  • Collect embryos at different Nieuwkoop and Faber stages

  • Analyze RNF217 expression throughout development

  • Correlate with known developmental changes in iron metabolism

  • Use whole-mount in situ hybridization to determine spatial expression patterns

These approaches will establish whether RNF217 expression in Xenopus responds to iron status similar to mammalian systems, providing insight into the conservation of iron regulatory mechanisms.

What are the challenges in analyzing RNF217 structure-function relationships?

Several technical challenges exist in studying RNF217 structure-function relationships:

Protein Purification Challenges:

  • As an E3 ligase, RNF217 may have inherent instability due to auto-ubiquitination

  • May require co-expression with deubiquitinating enzymes to improve yield

  • Consider adding proteasome inhibitors during purification

  • Use fusion tags (MBP, GST) to improve solubility

  • Purify under reducing conditions to maintain RING domain integrity

Structural Analysis Limitations:

  • X-ray crystallography challenges:

    • Obtaining diffraction-quality crystals of full-length RNF217

    • Consider crystallizing individual domains (RING domain)

    • Co-crystallize with E2 enzymes or substrate peptides

  • NMR spectroscopy approach:

    • Produce ¹⁵N/¹³C-labeled RNF217 domains in E. coli

    • Analyze solution structure of individual domains

    • Map binding interfaces with E2 enzymes and substrates

  • Cryo-EM considerations:

    • Full-length RNF217 may be too small for high-resolution cryo-EM (~30-40 kDa)

    • Consider analyzing RNF217 in complex with larger binding partners

Homology Modeling:
Due to structural determination challenges, homology modeling can provide insights:

  • Use structures of related RING E3 ligases as templates

  • Validate models through mutagenesis of predicted key residues

  • Perform molecular dynamics simulations to analyze conformational dynamics

Substrate Recognition Complexity:

  • RNF217 may recognize multiple substrates beyond ferroportin

  • Substrate recognition may be context-dependent or regulated by post-translational modifications

  • Use techniques like BioID or proximity labeling to identify interacting proteins in different contexts

Addressing these challenges requires integrating multiple approaches, from biochemical assays to computational modeling, to build a comprehensive understanding of RNF217 structure-function relationships.

How can deep proteomics approaches be used to identify novel RNF217 substrates in Xenopus laevis?

Identifying the full spectrum of RNF217 substrates requires sophisticated proteomics approaches:

Global Proteomics Strategy:

  • Generate RNF217 knockout or knockdown Xenopus embryos or tissues

  • Compare the proteome with wild-type samples using tandem mass spectrometry

  • Proteins that accumulate in the absence of RNF217 are potential substrates

  • Analysis should include:

    • At least 3 biological replicates

    • False discovery rate control (typically <1%)

    • Fold change threshold (>1.5-fold) with statistical significance (p<0.05)

Ubiquitinome Analysis:

  • Use tandem ubiquitin binding entities (TUBEs) to enrich ubiquitinated proteins

  • Compare ubiquitinome profiles between wild-type and RNF217-deficient samples

  • Identify sites with reduced ubiquitination in RNF217-deficient samples

  • Analyze ubiquitin chain topology to determine the types of chains formed by RNF217

Di-Gly Remnant Profiling:

  • Digest samples with trypsin, which leaves a di-glycine remnant on ubiquitinated lysines

  • Enrich peptides containing di-Gly remnants using specific antibodies

  • Analyze by LC-MS/MS to identify specific ubiquitination sites

  • Compare site occupancy between control and RNF217-deficient samples

Proximity-Based Labeling:

  • Generate a BioID or TurboID fusion of RNF217

  • Express in Xenopus embryos or cultured cells

  • Add biotin for labeling proteins in proximity to RNF217

  • Purify biotinylated proteins and identify by mass spectrometry

  • Validate candidates as direct substrates using in vitro ubiquitination assays

Data Analysis Pipeline:

Analysis StepToolsParameters
Protein IdentificationMaxQuantFDR < 1% at protein and peptide levels
QuantificationMaxQuant LFQMin. ratio count: 2
Statistical AnalysisPerseusANOVA with permutation-based FDR
Network AnalysisString-DB/CytoscapeHigh confidence interactions (0.7)
Pathway EnrichmentGSEA/DAVIDFDR < 0.05

The deep proteomics approach in Xenopus laevis can identify over 11,000 proteins with 99% confidence, allowing comprehensive analysis of the RNF217 substrate network .

How conserved is RNF217 function between Xenopus laevis and mammalian systems?

Understanding the evolutionary conservation of RNF217 involves comparative analyses across species:

Sequence Conservation Analysis:

Domain Architecture Comparison:
Compare the organization of functional domains across species:

  • RING finger domain position and sequence

  • Transmembrane domains if present

  • Substrate binding regions

  • Post-translational modification sites

Functional Complementation Tests:

  • Express Xenopus laevis RNF217 in mammalian cells with RNF217 knockout

  • Test whether Xenopus RNF217 can rescue the mammalian phenotype

  • Examine ferroportin degradation and iron export capability

  • Create chimeric proteins swapping domains between Xenopus and mammalian RNF217 to map species-specific functional regions

Regulatory Mechanism Comparison:

  • Compare the promoter regions of RNF217 genes across species

  • Identify conserved transcription factor binding sites

  • Examine whether Tet1-mediated demethylation regulation is conserved in Xenopus

  • Test whether iron status similarly affects RNF217 expression across species

These comparative approaches can reveal the core conserved functions of RNF217 and identify any species-specific adaptations in the iron regulatory system.

What technical adaptations are needed when translating RNF217 research protocols from mammalian systems to Xenopus laevis?

Adapting protocols from mammalian systems to Xenopus requires several important modifications:

Expression System Considerations:

  • Account for the allotetraploid nature of Xenopus laevis genome

  • Design primers and probes that can distinguish between homeologs (L and S subgenomes)

  • When available, use the L subgenome sequence for recombinant expression as it tends to be more predominantly expressed

Temperature Adaptations:

  • Adjust incubation temperatures for enzymatic reactions:

    • Xenopus optimal physiological temperature: 18-22°C

    • Mammalian systems typically use 37°C

  • For in vitro biochemical assays with purified proteins:

    • Test activity at both temperatures

    • Expect potentially lower activity at mammalian temperatures

Developmental Stage Considerations:

  • Use the updated Nieuwkoop and Faber staging system for Xenopus development

  • New reference illustrations are available on Xenbase for precise staging

  • Consider that iron metabolism varies significantly across developmental stages

Buffer System Modifications:

  • Standard buffers for Xenopus protein work:

    • Extraction: 20 mM HEPES pH 7.5, 100 mM KCl, 5% glycerol, 1 mM DTT

    • Ubiquitination assays: 50 mM Tris pH 7.5, 5 mM MgCl₂, 2 mM ATP, 0.5 mM DTT

Cell Culture Alternatives:

  • Primary Xenopus cell cultures require different conditions:

    • Lower temperature (22°C)

    • Simpler media formulations

    • No CO₂ requirement

  • Consider using Xenopus oocytes or early embryos for expression studies instead of established cell lines

Antibody Selection:

  • Test mammalian antibodies for cross-reactivity with Xenopus RNF217

  • Consider generating Xenopus-specific antibodies using unique epitopes

  • For immunoprecipitation, produce a recombinant His-tagged RNF217 to generate antibodies in rabbits

By making these technical adaptations, established mammalian protocols can be effectively translated to the Xenopus system for studying RNF217 function.

What are common pitfalls in recombinant RNF217 expression and purification from Xenopus laevis?

Several challenges may arise during RNF217 expression and purification:

Expression Challenges:

ProblemPossible CauseSolution
Poor expressionCodon biasUse codon-optimized sequence for expression host
Protein toxicityE3 ligase activity affecting hostUse inducible promoters with tight regulation
Inclusion body formationImproper foldingLower induction temperature; co-express chaperones
Proteolytic degradationIntrinsic instabilityAdd protease inhibitors; use protease-deficient strains
Auto-ubiquitinationNative E3 activityCo-express deubiquitinating enzymes; mutate catalytic RING domain

Purification Optimization:

  • Solubilization strategies:

    • If membrane-associated, test different detergents (DDM, CHAPS, Triton X-100)

    • For inclusion bodies, try solubilization with 8M urea followed by refolding

    • Consider fusion tags that enhance solubility (MBP, SUMO, TRX)

  • Purification conditions:

    • Maintain reducing conditions (1-5 mM DTT or 0.5-2 mM TCEP)

    • Include zinc (10-50 μM ZnCl₂) to stabilize the RING domain

    • Use buffer screening to identify optimal pH and salt concentration

  • Storage considerations:

    • Add glycerol (10-20%) to prevent freeze-thaw aggregation

    • Consider flash-freezing small aliquots in liquid nitrogen

    • Test activity immediately after purification and after storage

Quality Control Measures:

  • Verify protein identity by:

    • Western blotting with anti-RNF217 antibodies

    • Mass spectrometry peptide fingerprinting

  • Assess protein quality by:

    • Size exclusion chromatography to check for aggregation

    • Circular dichroism to verify secondary structure

    • Thermal shift assay to evaluate stability

These strategies address the most common challenges in obtaining active recombinant RNF217 protein for biochemical and structural studies.

How can I optimize morpholino or CRISPR-based knockdown of RNF217 in Xenopus laevis?

Effective gene targeting requires careful design and validation:

Morpholino Optimization:

  • Design considerations:

    • Target translation start site or exon-intron boundaries

    • Check for sequence conservation between L and S homeologs

    • Avoid regions with secondary structure

    • Test 2-3 different morpholinos per gene

  • Delivery optimization:

    • Inject 1-2 pmol into one-cell stage embryos

    • Include fluorescent tracer to verify injection

    • Titrate dose to minimize toxicity while maintaining knockdown

  • Validation methods:

    • Western blotting to confirm protein reduction (>70%)

    • RT-PCR to verify splicing changes for splice-blocking morpholinos

    • Rescue experiments with morpholino-resistant mRNA to confirm specificity

CRISPR/Cas9 Optimization:

  • sgRNA design:

    • Target early exons or critical functional domains

    • Check for off-target sites using CRISPRscan or similar tools

    • Design sgRNAs targeting both L and S homeologs if present

    • Use 2-3 sgRNAs per gene for higher efficiency

  • Delivery parameters:

    • Test different ratios of Cas9 protein (500-1000 pg) to sgRNA (200-400 pg)

    • Inject into one-cell stage embryos for global knockout

    • For tissue-specific knockout, use appropriate tissue-specific promoters

  • Efficiency assessment:

    • T7 endonuclease assay on PCR products from target region

    • Direct sequencing of target region

    • Surveyor nuclease assay

    • High-resolution melt analysis (HRMA)

Validation Controls:

  • Include standard control morpholino or non-targeting sgRNA

  • Test for effects on embryonic development and survival

  • Perform functional assays (e.g., tissue iron levels, ferroportin stability)

  • Rescue experiments with wild-type or mutant RNF217 mRNA to confirm specificity

  • Use the Trim-Away technique as an orthogonal approach for protein depletion

Careful optimization of these parameters will maximize knockdown efficiency while minimizing off-target effects and toxicity.

What controls should be included when studying RNF217-mediated ubiquitination in Xenopus systems?

Robust controls are essential for accurate interpretation of ubiquitination assays:

Essential Controls for In Vitro Ubiquitination Assays:

Control TypeDescriptionPurpose
Negative controlOmit E1 enzymeVerify ATP/E1 dependence
Negative controlOmit E2 enzymeConfirm E2 requirement
Negative controlOmit RNF217Demonstrate E3 dependence
Negative controlRING domain mutant RNF217 (e.g., C→A in zinc coordination site)Confirm catalytic activity requirement
Positive controlKnown E3-substrate pair (e.g., MDM2-p53)Validate assay conditions
Specificity controlUnrelated substrate proteinConfirm substrate specificity
Ubiquitin variantLysine-less ubiquitin (K0)Determine chain formation ability
Ubiquitin variantK48R or K63R mutantsIdentify chain linkage preference

Controls for Cellular Ubiquitination Assays:

  • Expression controls:

    • Vector-only transfection

    • Catalytically inactive RNF217 mutant

    • Proteasome inhibitor treatment (MG132) to stabilize ubiquitinated proteins

  • Specificity controls:

    • Non-substrate proteins to demonstrate selectivity

    • Substrate mutants lacking predicted ubiquitination sites

    • Dominant-negative E2 enzymes to block specific ubiquitination pathways

  • Technical controls:

    • Denaturing conditions during lysis and immunoprecipitation to disrupt non-covalent interactions

    • DUB inhibitors (NEM, IAA) to prevent deubiquitination during sample processing

    • Sequential immunoprecipitation to confirm direct ubiquitination

Validation in Xenopus Embryos:

  • For developmental studies:

    • Stage-matched wild-type controls

    • Rescue with wild-type RNF217 mRNA

    • Dose-dependent analysis of phenotypes

  • For tissue-specific effects:

    • Contralateral uninjected side as internal control

    • Lineage tracers to mark manipulated cells

    • Targeted versus global knockdown comparisons

Incorporating these controls ensures that observed ubiquitination is specifically mediated by RNF217 and helps distinguish direct versus indirect effects on substrates.

How can multi-omics approaches advance our understanding of RNF217 biology in Xenopus laevis?

Integrating multiple omics technologies provides comprehensive insights into RNF217 function:

Integrated Omics Strategy:

  • Transcriptomics:

    • RNA-seq analysis of RNF217 knockout/knockdown embryos or tissues

    • Identify differentially expressed genes involved in iron homeostasis

    • Compare with transcriptomic changes in iron deficiency/overload

    • Xenopus RNA-seq can identify >90% of peptides detected in proteomics studies

  • Proteomics:

    • Quantitative proteomics comparing wild-type and RNF217-deficient samples

    • Ubiquitinome analysis to identify RNF217-dependent ubiquitination events

    • Protein turnover studies using pulse-chase SILAC

    • Deep proteomics of Xenopus samples can identify >11,000 proteins

  • Metabolomics:

    • Targeted analysis of iron-related metabolites

    • Untargeted metabolomics to discover novel metabolic pathways affected by RNF217

    • Stable isotope tracing to track iron flux

  • Epigenomics:

    • ChIP-seq for histone modifications at iron-regulated genes

    • ATAC-seq to identify changes in chromatin accessibility

    • DNA methylation analysis to examine Tet1-dependent regulation

Data Integration Approaches:

  • Multi-omics factor analysis to identify coordinated changes across datasets

  • Network analysis to construct RNF217-centered regulatory networks

  • Machine learning approaches to predict RNF217 substrates from combined datasets

  • Comparative analysis with mammalian multi-omics datasets

Application to Xenopus Development:

  • Stage-specific analysis to map temporal changes in RNF217 function

  • Tissue-specific profiling to identify context-dependent activities

  • Response to iron status changes during metamorphosis

  • Comparison between closely related species (X. laevis vs. X. tropicalis)

The multi-omics approach leverages the genomic resources available for Xenopus laevis to build a systems-level understanding of RNF217 function in iron homeostasis and beyond.

How does RNF217 function in developmental contexts in Xenopus laevis?

Understanding RNF217's role during development requires stage- and tissue-specific analyses:

Developmental Expression Analysis:

  • Perform qRT-PCR, western blotting, and in situ hybridization across Nieuwkoop and Faber developmental stages

  • Create developmental expression maps using the new standardized Xenopus development illustrations

  • Correlate expression with key developmental transitions, particularly during metamorphosis when thyroid hormone drives dramatic tissue remodeling

Stage-Specific Requirements:

  • Use targeted CRISPR or morpholino injections at different developmental timepoints:

    • Microinjection at one-cell stage for early development

    • Targeted injections into specific blastomeres for tissue-restricted analysis

    • Heat-shock inducible Cas9 systems for temporal control

  • Phenotypic analysis should include:

    • Morphological development using standardized staging criteria

    • Tissue iron quantification at different stages

    • Ferroportin levels and localization

    • Blood parameters (hemoglobin, hematocrit) if studying erythropoiesis

Tissue Remodeling During Metamorphosis:

  • RNF217 may play critical roles during the extensive tissue remodeling in metamorphosis

  • Examine coordination with type I iodothyronine deiodinase (D1) activity

  • Compare RNF217 function in tissues undergoing:

    • Apoptosis (tail regression)

    • Proliferation (limb development)

    • Remodeling (intestine, liver)

  • Test whether thyroid hormone signaling regulates RNF217 expression or activity

Interspecies Developmental Comparisons:

  • Compare developmental expression and function between:

    • Xenopus laevis (allotetraploid)

    • Xenopus tropicalis (diploid)

  • Analyze potential subfunctionalization of homeologs in X. laevis

  • Correlate with species-specific differences in iron metabolism during development

These developmental studies may reveal novel stage-specific functions of RNF217 beyond iron homeostasis regulation, particularly during the dramatic tissue remodeling of metamorphosis.

What are promising strategies for developing tools to study RNF217 dynamics in live Xenopus cells or tissues?

Innovative approaches for real-time analysis of RNF217 activity include:

Fluorescent Protein Fusions:

  • Generate N- or C-terminal fluorescent protein fusions (e.g., mEGFP-RNF217)

  • Validate function by testing ferroportin degradation activity

  • Establish stable transgenic Xenopus lines using:

    • I-SceI meganuclease-mediated transgenesis

    • Tol2 transposase-mediated integration

    • CRISPR knock-in strategies

  • Use for real-time imaging of RNF217 localization during development or in response to iron status changes

FRET-Based E3 Ligase Activity Sensors:

  • Design RNF217-substrate FRET pairs:

    • RNF217-mCerulean and Ferroportin-mVenus

    • Monitor FRET signal loss as indication of substrate degradation

  • Ubiquitin-based FRET sensors:

    • Substrate-mCerulean and mVenus-Ubiquitin

    • FRET increases upon ubiquitination

Bimolecular Fluorescence Complementation (BiFC):

  • Split fluorescent protein approach:

    • Fuse N-terminal half of Venus to RNF217

    • Fuse C-terminal half to potential interaction partners

    • Fluorescence occurs only upon protein interaction

  • Particularly useful for capturing transient E3-substrate interactions

  • Can be combined with tissue-specific promoters for in vivo studies

Optogenetic Control of RNF217 Activity:

  • Develop light-inducible RNF217 activation:

    • Fusion with photosensitive domains (CRY2/CIB1, PhyB/PIF)

    • Light-induced dimerization brings RNF217 to substrates

  • Apply in Xenopus embryos transparent nature enables light penetration

  • Achieve spatiotemporal control of RNF217 activity during development

CRISPR-Based Endogenous Tagging:

  • Use CRISPR/Cas9 to insert tags at endogenous RNF217 locus:

    • Fluorescent protein tags for visualization

    • HaloTag or SNAP-tag for pulse-chase experiments

    • Split-GFP complementation for protein interaction studies

  • Maintains native expression levels and regulation

  • Can be combined with tissue-specific Cas9 expression

These emerging technologies will facilitate detailed spatiotemporal analysis of RNF217 dynamics and function in the context of living Xenopus cells and tissues.

How might studies of RNF217 in Xenopus laevis inform potential therapeutic strategies for iron disorders?

Insights from Xenopus RNF217 research could translate to therapeutic applications:

Therapeutic Target Identification:

  • Xenopus allows rapid screening of potential drug targets in the RNF217-ferroportin pathway

  • Advantages for drug target validation:

    • External development allows easy compound administration

    • Large numbers of embryos enable high-throughput screening

    • FETAX (Frog Embryo Teratogenesis Assay-Xenopus) protocols established for toxicity testing

    • Optical transparency permits visualization of effects

Therapeutic Strategy Development:

  • Inhibition of RNF217 to increase ferroportin levels and iron export:

    • Potential application in iron overload disorders

    • Screen for small molecules that disrupt RNF217-ferroportin interaction

    • Identify compounds that inhibit RNF217's E3 ligase activity

  • Enhancement of RNF217 activity to decrease ferroportin and limit iron export:

    • Potential application in iron deficiency anemia

    • Screen for compounds that stabilize RNF217 or enhance its activity

    • Identify regulators of RNF217 expression

Comparative Pharmacology:

  • Test whether drugs targeting mammalian RNF217 have similar effects in Xenopus

  • Identify conserved vs. species-specific drug responses

  • Use Xenopus as a complementary model to rodents for preclinical studies

  • Leverage the well-characterized developmental stages to assess safety during different life stages

Novel Biomarker Identification:

  • Proteomics studies in Xenopus may identify novel RNF217-regulated proteins

  • These could serve as biomarkers for iron disorders or therapeutic response

  • Validate identified biomarkers in mammalian systems

  • Develop diagnostic assays based on conserved biomarkers

These translational approaches highlight how fundamental research in Xenopus laevis can contribute to therapeutic innovation for iron disorders, leveraging the unique advantages of this model system while maintaining focus on conservation with human biology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.